KEGG   Rattus norvegicus (rat): 365191Help
Entry
365191            CDS       T01003                                 

Gene name
Chmp2a, RGD1305050
Definition
(RefSeq) charged multivesicular body protein 2A
  KO
K12191  charged multivesicular body protein 2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    365191 (Chmp2a)
  09143 Cell growth and death
   04217 Necroptosis
    365191 (Chmp2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    365191 (Chmp2a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    365191 (Chmp2a)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    365191 (Chmp2a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   365191 (Chmp2a)
  Exosomal proteins of other body fluids (saliva and urine)
   365191 (Chmp2a)
  Exosomal proteins of colorectal cancer cells
   365191 (Chmp2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 DUF2570 YlqD
Motif
Other DBs
NCBI-GeneID: 365191
NCBI-ProteinID: NP_001102376
RGD: 1305050
Ensembl: ENSRNOG00000043328
UniProt: B2RZB5
Position
1q12
AA seq 222 aa AA seqDB search
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEATASALADADADLEERLKNLRRD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttgtttgggcgccggaagacgccagaggaactacttcggcaaaaccagagg
gccctgaaccgagccatgagagaactggacagggaacgacaaaaactagaaacccaggaa
aagaaaatcattgcagacatcaaaaagatggcaaagcaaggccagatggatgctgttcga
atcatggcaaaagacctggtgcgtacccggcgatatgtgcgcaagtttgtgttgatgcgg
gccaatatccaggctgtgtccctcaagatacaaactctaaaatccaacaactcaatggca
caagccatgaagggtgttactaaggccatgggcaccatgaacagacagctgaaattaccc
cagatccagaagatcatgatggagtttgaacggcaggcagagatcatggacatgaaggaa
gaaatgatgaatgatgccattgatgatgcaatgggtgatgaggaagatgaagaggagagt
gatgctgttgtgtcccaggtactggatgagctgggactgagcctcacagatgagctgtca
aacctcccctccactggaggctcactcagtgtggctgctggcggaaagaaagcagaggcc
acagcctcagctctggctgatgctgatgcagacctggaagagaggctcaagaaccttcgc
agggactga

DBGET integrated database retrieval system