KEGG   Rattus norvegicus (rat): 365215Help
Entry
365215            CDS       T01003                                 

Gene name
Smg9, RGD1309888
Definition
(RefSeq) SMG9 nonsense mediated mRNA decay factor
  KO
K18735  protein SMG9
Organism
rno  Rattus norvegicus (rat)
Brite
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     365215 (Smg9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Smg8_Smg9
Motif
Other DBs
NCBI-GeneID: 365215
NCBI-ProteinID: NP_001014265
RGD: 1309888
Ensembl: ENSRNOG00000019596
UniProt: Q5PQS6
Position
1q21
AA seq 520 aa AA seqDB search
MSESGHSQPGLYGIERRRRWKEPGSSGPQNLSGPGGRERDYIAPWERERRDGSEDPSTNV
MQKTPIILSKPPAERSKQPPPSTAPAAPPAPAPLEKPIVLMKPREEGKGPVAATGASTPE
GTAPPPPTAPAPPKGEKEGQRPTQPVYQIQNRGMGTAAPTAMDPVVGQAKLLPPERMKHS
IKLVDDQMNWCDSAIEYLLDQTDVLVVGVLGLQGTGKSMVMSLLSANTPEEDQRAYVFRA
QSAEMKERGGNQTSGIDFFITQERIVFLDTQPILSPSILDHLINNDRKLPPEYNLPHTYV
EMQSLQIAAFLFTVCHVVIVVQDWFTDLSLYRFLQTAEMVKPSTPSPSHESSSAAGSDEG
TEYYPHLVFLQNKARREDFCPRKLRQMHLMIDQLMAHSHLRYKGTLSMLQCNIFPGLPPD
FLDAEVNLFLVPFMDSEAENENPPRAGPGSSPLFSLLPGYRGHPSFQSLVSKLRSQVMSM
ARPQLSHTILTEKNWFHYAARIWDGVKKSSALAEYSRLLA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagtctgggcacagtcagcctgggctctacgggatagagcggcggcggaggtgg
aaagagccaggctccagtggcccccagaatctttctgggcctggcggtcgggaaagagac
tacattgccccctgggaaagagagagacgggatggcagcgaagaccccagcaccaacgtc
atgcagaaaacccccatcatcctctcaaagcctccagctgagcggtcaaagcagccacca
cctagtacagccccagctgcaccgccagccccagccccactggagaaacccattgtgctc
atgaagccacgtgaggaggggaaggggcctgtggctgcaacaggggcttccacccccgaa
ggtactgccccaccaccccccacggcccctgcaccaccaaaaggagagaaggaggggcag
agacccacacagcctgtgtaccagattcagaaccggggcatgggcactgctgccccaact
gccatggaccctgtggtgggccaggctaagctcctacccccggagcgcatgaagcacagc
atcaagctggtagacgaccagatgaactggtgtgacagcgccattgagtacctgctggat
cagacggacgtgttagtggtcggtgtcttaggcctccaggggacaggcaagtccatggtc
atgtcactgctgtcagcaaacactccagaggaagaccagagggcgtacgtcttccgggct
cagagtgcggagatgaaggaacgagggggcaaccagaccagcggcattgacttcttcatt
acccaagagcggattgtcttcctagacacgcagcccatcctcagcccgtccatcttggac
cacctcatcaataacgaccgcaaactgcctccggagtataacctccctcacacctatgtg
gaaatgcagtccctgcagatagctgccttcctcttcacggtctgccacgtggtgatcgtc
gtgcaggattggttcacggacctcagtctgtacaggttcctgcaaacagcagagatggtg
aagccatcgactccatcccccagccatgagtccagcagcgcggcaggctcggatgagggc
actgagtactacccgcacctcgtcttcctgcagaacaaggcacgtagggaggacttctgt
ccccggaagttacgtcagatgcacctaatgattgaccagcttatggcacattcccacctg
cgctacaaggggacgctgtccatgctgcagtgcaacatcttcccagggctgccgcccgac
ttcctggacgctgaggtcaacttgttcctggtgcccttcatggacagtgaagctgagaat
gagaacccacctcgagcagggcctggatccagccccctcttctccctgctgcctgggtac
cgaggtcaccctagcttccagtccctggtcagcaagctccgcagccaggtgatgtcaatg
gctcggccacagctgtcgcacacaatcctcacggagaagaactggttccactatgctgcc
agaatctgggatggggtgaagaagtcctcagccctggcagagtacagccgcttgctggcc
tga

DBGET integrated database retrieval system