KEGG   Rattus norvegicus (rat): 365228
Entry
365228            CDS       T01003                                 

Gene name
Ffar3, Gpr41
Definition
(RefSeq) free fatty acid receptor 3
  KO
K04326  free fatty acid receptor 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    365228 (Ffar3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    365228 (Ffar3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Git3
Other DBs
NCBI-GeneID: 365228
NCBI-ProteinID: NP_001102382
RGD: 1311035
Ensembl: ENSRNOG00000037467
UniProt: B2GV46
Position
1q21
AA seq 319 aa
MDTSFFPGNHWLFFSVDLLVFLVGLPLNVMALVVFVNKLRRRPVAVDLLLLNLTISDLLL
LLFLPFRIVEAACGMKWILPFIFCPLSGFLFFTTIYLTSLFLMTVSIERFLSVAYPLWYK
TRPRLAQAGLVSGICWFLASAHCSVIYVTEYWGNATYSQGTNGTCYLEFREDQLAILLPV
RLEMAVVLFMVPLCITSYCYSRLVWILSQGASRRRRKRVMGLLVATLLIFFVCFGPYNMS
HVVGYVRGESPTWRSYVLLLSTLNSCIDPLVFYFSSSKFQADFHQLLSRLIRACVPWTQE
VSLELKVKNGEEPSKECPS
NT seq 960 nt   +upstreamnt  +downstreamnt
atggacacaagcttctttcccggcaaccactggcttttcttttcagtggatctgttggtg
ttcctcgtgggactacccctcaacgtgatggccctggtggtcttcgtgaacaagctgcgt
cgccgcccggtggccgtggacttacttttgcttaacctgaccatttcggacctgcttctg
ctcctcttcctgccattccgtatagtggaggcggcctgtggcatgaaatggattctgccc
ttcatcttctgccccctttctggcttccttttcttcaccaccatctacctcacctccctc
ttcctgatgacggtgagcatagaacgttttctgagcgtagcctacccactgtggtacaaa
acccggccccggctggcccaggctggtctggtcagtggcatctgttggttcttggcatca
gctcactgtagtgtgatttatgtcactgaatactggggaaatgcaacctacagccagggg
accaacggaacctgctacctggaattccgggaggaccagctggccatcctcctccccgtg
cgactggaaatggctgtggtccttttcatggtgcccctgtgtattaccagttactgctac
agtcgcctggtgtggattctgagccagggagccagccggcgcaggcgcaagagagtgatg
gggcttcttgtagccacgttgctcatcttctttgtctgcttcggcccctacaatatgtcc
cacgtggtgggctacgtgcgcggtgagagtccgacctggcggagctacgtgcttctcctc
agcaccctcaactcttgtattgaccctctggttttctacttttcatcctccaagttccaa
gccgactttcatcagctcctgtctaggctgatcagagcttgtgtgccttggactcaggaa
gtcagcttggaactgaaggtaaagaacggagaagagccatccaaggaatgtccgagctag

DBGET integrated database retrieval system