KEGG   Rattus norvegicus (rat): 365241
Entry
365241            CDS       T01003                                 

Gene name
Kcna7
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 7
  KO
K04880  potassium voltage-gated channel Shaker-related subfamily A member 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    365241 (Kcna7)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   365241 (Kcna7)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 DUF423
Other DBs
NCBI-GeneID: 365241
NCBI-ProteinID: NP_001102384
RGD: 1309632
Ensembl: ENSRNOG00000020779
UniProt: D4A810
Position
1q22
AA seq 489 aa
MLFLRADTGHPAGVAAASGPHVRSPVARAVRAMEPRCPPPCGCCERLVLNVAGLRFETRA
RTLGRFPDTLLGDPVRRSRFYDGARREYFFDRHRPSFDAVLYYYQSGGRLRRPAHVPLDV
FLEEVSFYGLGAAALARLREDEGCAVPPERPLPRRAFARQLWLLFEFPESSQAARVLAVV
SVLVILVSIVVFCLETLPDFRDDRDDPGLAPVAAATGSFLARLNGSSPMPGAPSRQPFND
PFFVVETLCICWFSFELLVRLAACPSKAVFFKNVMNLIDFVAILPYFVALGTELARQRGV
GQPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFS
SAVYFAEVDRADTHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTIS
LPVPVIVSNFSYFYHRETEGEEAGMYSHVDTQPCGTLEGKANGGLVDSEVPELLPPLWAP
SGKHMVTEV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgctatttttacgcgcggacaccggacacccggctggggtggctgcggcgtcggggcca
cacgtccgttcaccggtcgcccgggctgtgcgcgccatggagccacggtgcccgccgccc
tgcggctgctgcgagcggctggtgctcaacgtggccgggttgcgcttcgagacccgcgcg
cgcacgctcggccgcttcccggacacgctgctgggggacccggtgcgccgcagccgcttc
tacgacggcgcgcgccgcgagtatttcttcgaccgacaccggcccagcttcgatgcggtg
ctctactactaccagtcaggcggccggctgagacggccggcgcacgtgcccctcgacgtc
ttcctggaggaggtgtccttctacgggctgggtgcggcggcgctggcgcggctgcgagag
gatgagggctgcgccgtgccgcccgagcggccgctgccccgccgcgcctttgcgcgccag
ctctggctgctcttcgaattccccgagagctcgcaggctgcgcgcgtgctcgccgtggtc
tccgtgctcgtcatcctggtctccatcgtggtcttttgcctggagacgctgccagacttc
cgcgacgaccgcgatgacccggggctcgcgccggtagcggctgctactggctcgttcctc
gctcggctcaatggctccagtcccatgcccggagctccttcccgacagcccttcaacgat
ccattctttgtggtggagaccctgtgtatctgctggttctcctttgagctgctggtgcgt
ctggcggcgtgtccaagcaaagctgtatttttcaagaatgtgatgaaccttattgacttc
gtggccatcctgccttactttgtggccctgggcacagagttagcccgtcagcggggcgtg
ggccagccagctatgtccctggccatcctaagggtcatcagattggtgcgtgttttccgc
atcttcaagctatccaggcattcgaagggcctgcagatcttggggcagacactgcgggct
tccatgcgagagctaggtctcctcatcttcttcctcttcatcggcgtggtcctcttttcc
agcgcagtctactttgctgaagtggaccgggcggacacccatttcaccagcatcccagag
tccttttggtgggcagtggtcaccatgaccacggtcggctacggggacatggcacctgtc
accgtgggtggcaagatcgtgggctctctgtgtgccattgcaggcgtgctcaccatctct
ctgccggtgcctgtcatcgtctccaacttcagctacttttaccaccgggagacagagggc
gaagaggcagggatgtacagccatgtggacacacagccctgcggtacactggagggcaag
gccaatgggggtctggtggactctgaggtgcctgaactccttccaccactctgggcccct
tctgggaaacacatggtgaccgaggtgtga

DBGET integrated database retrieval system