KEGG   Rattus norvegicus (rat): 365265Help
Entry
365265            CDS       T01003                                 

Gene name
Tmprss11b, Hatl5, Tmprss11bnl
Definition
(RefSeq) transmembrane protease, serine 11B
  KO
K09751  transmembrane protease serine 11B [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    365265 (Tmprss11b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     365265 (Tmprss11b)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   365265 (Tmprss11b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SEA DUF1986 Trypsin_2 DUF3094
Motif
Other DBs
NCBI-GeneID: 365265
NCBI-ProteinID: NP_001004020
RGD: 1303278
Ensembl: ENSRNOG00000002002
UniProt: Q6IE14
Position
14p21
AA seq 420 aa AA seqDB search
MTVSKLRPVIASRKSFPPWMIILGVLGVLAILGLIIGLLVHFLAVENKIYYYQGSFKVLN
IPYDRNYERETSLESNYLSKILEIKMVDAFESSNIYKQYINSQIITLVPENNSVTAHIWL
VFKDPWSNKENLRRRIESILHQMLENNSGSLTTDPGSLKLTEITKVDAEKIINNRCGRRP
RMSATYDRITGGSTAQKGEWPWQASLRVNGKHHCGASLIGERFLLTAAHCFLRTNNPKNL
TVSFGTRVTPAYMQHYVEEVIIHEDYVKGQHHDDVAIIKLTEKVSFRNDVHRVCLPEATQ
VFPPGEGVVVTGWGSLSYNGKSPLLLQKASIKIIDTNACNSEEAYGGRIMDTMLCAGYME
GYVDACQGDSGGPLVHPNSRDIWYLVGIVSWGHECGRVNKPGVYMRVTSYRDWIASKTGI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttctaagctgagaccagtcatagcatcccgcaaatctttcccaccatggatg
atcatcctcggtgtgcttggagtgctggccatccttgggctaattattggactcttagtt
cacttcctggcagtagaaaacaagatctactactatcaaggtagttttaaagttctgaat
attccatatgacagaaattatgaaagagagacatcactagaaagtaactacctcagtaaa
atcctcgagattaaaatggttgatgcctttgagagttctaacatttataaacaatatatc
aactctcagatcatcacattggtgcctgaaaacaacagcgtgacagcacatatatggctg
gtgtttaaggacccctggtcaaacaaggaaaacctaagaagaagaattgaaagcatctta
catcagatgctggagaacaactcgggatccttgactacagatcctgggtctctgaagctc
acggaaatcactaaagttgatgctgagaagattatcaacaaccgttgcgggagacggcca
agaatgtcggcaacctatgacagaatcacgggaggctccacggctcagaaaggagaatgg
ccttggcaagcgagtctcagggtgaatggcaaacaccactgtggagcatctctcattggc
gaaagattcctgctaacagcagcgcattgctttctcaggacaaataatccaaagaactta
actgttagctttggcactagagtaactccagcctacatgcagcattatgttgaagaagtt
attatccatgaagattatgttaaggggcagcatcatgatgatgtcgcaattataaagctc
actgaaaaagtttcattcaggaatgacgtacatcgggtttgcctcccggaagccacacag
gttttcccaccaggggaaggggtcgttgttacaggatggggatcactttcttacaatggt
aaatccccactgttacttcagaaagcatccattaaaattatcgatacaaatgcttgcaat
tctgaagaagcttatggaggcaggataatggacacaatgctctgcgctggttacatggaa
ggctatgtcgatgcttgccagggtgactctggaggacccctagttcatcccaattctcga
gatatttggtaccttgttgggatagtgagctggggacatgaatgtggcagagtcaacaag
ccaggggtctatatgagagtgacttcctaccgtgactggattgcctccaagactggtatc
tag

DBGET integrated database retrieval system