KEGG   Rattus norvegicus (rat): 365298
Entry
365298            CDS       T01003                                 

Gene name
Alpk3, RGD1309860
Definition
(RefSeq) alpha-kinase 3
  KO
K08868  alpha-kinase
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    365298 (Alpk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   365298 (Alpk3)
SSDB
Motif
Pfam: Alpha_kinase I-set Ig_3 Ig_2 ig C2-set_2 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 365298
NCBI-ProteinID: NP_001178824
RGD: 1309860
Ensembl: ENSRNOG00000011659
UniProt: D3ZH28
Position
1q31
AA seq 1684 aa
MGSRRALGRGWGLGGRAGTGGDGEDDGPVWTPGPASRSYLLSVRPEASLSSNRLSHPSSG
RSTFCSIIAQLTEETQPLFETTLKSRAVSEDSDVRFTCIVTGYPEPEVTWYKDDIELDRY
CGLPKYEITHQGNRHTLQLYRCREEDAAIYQASARNTKGIVSCSGVLEVGTMTEYKIHQR
WFAKLKRKAAAKMREIEQSWKHGKEASGEADTLRKISPDRFQRKRRLSGAEEAVLPAPLR
GTEEGPSAAWQEGEAESTQHPGLGMINSFAPGEAPTNGEPAPENGEDGEHGLLTYICEVM
ELGPQNTPPKESGAKKKRKDEESKPGGQKPELGKAEGSQCSSENGIPSSDKLNSSRREKK
SRDVQPTQNQTRDRVARGPGPSGIESTRKTASVLGTQDKVQDVPALAPAPAPAPAPVPVP
APAPVPSLSSEQVYFSLKDMFMESTRAGRSQEEEKSPPPSTRVAGESPSGKVPVKARGEK
VPMVSGQPTSSTVPPPIKPLNRKRFAPPKSKVESTTSSSSSQTPESVAQSLGKAPPPASA
QVPTPPARRRHGTRESPLQGQTSHKTPGEALESPATMAPATSASSSSDTISVGHSTSGNQ
GVTEPMDTETQEEGRTLANGRTSGRQKTQTDGKLQVDGRTQGDEAQTLQRTQTNEKAPMN
VVTQGSERPESDRSSQKDLVTQRRVDTQVGQTQAGERWQQDPRDARIQEEKETQSVGSIP
TALETQPEQPSVVSLSSVPGALKLSPSECPTEPQATECSERSTEASYIQEKSGLMLGSEE
ADFRSHENTLLGPPSGNHTYSTQLPTEGNSEHLVGETHQRPEWLGEAKQEDSLLQSPKKE
QLQETLYVDLAIGHSADLSQEVPSLPSLPGTDLTNSLQEGLPSTTASQHTNADVPLPSPD
QDLPSSAPTLQLGPGSPTQSHPPEVMATSSEGACAKEPDVDGRSSGTRSCDPGLIDSLKN
YLLLLLKLSSPEAGEARAESQEVPATGGLTSSSALVPTVEVAGLSPRTSRRILDRVENNH
LVQSAQTLLLSPCTSRRLTGLLDREVQAGQQALAAAQCSRGPCPSPSPLTIPAIVVGEEG
SATGEGEDSRERTSQESDKAGLLGEVDGQTVESRTQEPCQEEAIPGEALTGLPAATPEEL
ALGARRKRFLPKVRAGSDGEVNKAEERESPTVSPRGPRKGLAPGSPGTPGRERRSPTQAR
KASMLEVPGTEEEPASGDLVTRPKASGLESEPAVDEGKQEALAKPRKAKDLLKAPQVIRK
IRVEQFPDSSGSLKLWCQFFNIVSDSVLTWAKDQHLVGEVSRSAGDEGPAALAIVQASPT
DCGLYRCTIQNEHGSASTDFRLSPEVLSGFISREEGEVGEEIEMTPMVFAKGLADSGCWG
DKLFGRLVSEELRGGGHGLQKASRAKVIYGLEPIFESGRTCIIKVSSLLVFGPSSETSLL
GRNYDVTIQGCKIQNMSREYCKIFAAETRAASGFGEVPEIIPLYLIYRPANNIPYATLEE
DLGKPLQTYCSRQWSCAGAPAASSSLEPVQKCQTFQHWLYQWTNGSFLVTDLAGADWKMT
DVEIATKLRGYQGLKESCFPALLDQFASSHQCNTYCEMLGLKPLKGPEGAHPQTKAKGSK
SPSAGRKGSQLSPQPQKKGLPSPQGSRKSAPSSRATPQASQEATLQLLGQPPAQEGSSKA
QGMR
NT seq 5055 nt   +upstreamnt  +downstreamnt
atggggtcgcggagggccttgggccggggctggggcctgggtggtcgagcaggaaccggt
ggagatggcgaggacgacgggccggtgtggactcctggcccagccagtcgcagctacttg
ctcagcgtgcggccggaggctagcttatcaagcaaccggttgtctcaccccagctctgga
aggagcaccttctgctccatcattgctcagcttacagaggagacccagccgctgtttgag
accacactcaagtcccgagctgtgtccgaagacagtgatgtcaggttcacctgcattgtc
acaggatacccagagccagaggtgacctggtacaaggatgacatagaactggaccgttac
tgtggcttgccaaaatacgagatcactcaccaaggcaaccggcacaccctgcagctgtac
aggtgtcgggaagaagatgctgccatctaccaggcctctgcccggaacaccaagggcatc
gtgtcttgctcaggggtcctagaggtgggcactatgacggagtacaagattcaccagcgc
tggttcgccaagttgaagcgtaaggctgcggccaagatgagggagattgagcagagctgg
aagcacgggaaagaggcttcaggggaggctgacacacttcgcaagatcagcccggaccgc
ttccaaagaaagcgccgactgagtggagcggaagaggcagtcctcccggcgccactcagg
ggaacggaggaagggccctcagcagcttggcaggaaggagaggctgagtccactcagcac
ccaggtttggggatgatcaacagtttcgctcctggtgaggcacccaccaatggggagcct
gccccagagaacggggaggacggagagcacggcctgctgacctacatctgtgaggtcatg
gaactggggcctcagaacacccctccaaaggagtctggggctaagaagaaaaggaaggat
gaggaatctaaaccaggagggcagaaaccagagttagggaaggcagaagggagccagtgc
tcttcagaaaatggcatccctagctcagacaaactcaattccagtagaagggagaagaag
tccagggatgtgcagccaactcagaaccagaccagagacagggtagcacgggggcctggg
ccttctgggatagaaagcaccaggaagacagcctctgttctgggtactcaagacaaggtc
caggatgtcccggccctggccccggcccccgccccggcccccgctcctgtcccagtccct
gcacccgcccctgttccaagcctcagctcagagcaggtgtatttctcgctgaaggacatg
ttcatggagagcacccgggcaggcaggtcccaggaagaggaaaaatctccacctccaagt
accagagtagctggagaaagtccttcagggaaggtacctgtcaaggctagaggggagaag
gtacctatggtctctggccagcccacgtcttccacggtgcccccgcctattaaacctttg
aacaggaagagatttgcccctcctaaatccaaagtggagtcaactacctcctcttcctca
agtcagactccagaatctgtggcccagagcttagggaaggccccaccgccagcctctgcc
caggtcccaacaccccctgcccgacggagacatggcactcgagagagccccttgcaagga
caaacaagccacaagactccaggagaggctctggagtccccagcaaccatggcccctgcc
acgtctgccagcagcagttccgataccatctctgttggtcacagcacctctgggaatcaa
ggtgtcacggagcccatggatacagaaactcaggaagaggggaggacacttgccaatggg
agaaccagtggcaggcagaaaacacagacagacggaaagttgcaagtggatgggaggact
cagggagacgaagcacaaactttgcagaggacacagacaaatgagaaggcaccgatgaac
gttgtaacacaaggaagcgaaaggccagagtcagacaggagttcacagaaggatttggtg
acacagagaagggtggatacacaggtaggacagacacaggcaggtgagaggtggcagcaa
gacccgagagacgcaaggatacaggaggaaaaggagacacagtcagtgggcagcattccc
acagctttggaaacccaaccagaacaaccgtctgtggtcagtctcagctcagtaccagga
gccctcaaactctcgccgtcagagtgccctacagagcctcaggctacagaatgttctgag
aggagcacagaagcatcttacatccaagaaaagtcaggcttgatgcttggatctgaagag
gcagacttcagaagccatgagaacactctgctagggcccccatcagggaaccatacctac
tcaacacagttgcccactgagggcaactcagagcatctggtaggagaaacacaccaaagg
ccagagtggttaggtgaggccaagcaggaggacagcctgcttcagagtcccaagaaggag
cagctccaggagacgctgtatgtggatctcgctattggacattcagcggacttgagtcag
gaggtgcccagtctgccttctcttcctggaactgacctaaccaatagtctgcaggagggg
ctacccagcaccacagcttctcagcacacaaacgctgatgtccccctcccctccccggac
caggacctgcccagttctgctcccactctgcaactgggaccagggtccccgactcagagt
cacccaccagaagtcatggctactagcagtgagggagcctgtgccaaggagccagatgtg
gacgggaggtcctcaggtacccggagctgtgaccctggccttatagactccctgaagaac
tacttgctcctgctgctaaagctatccagtccagaggcaggcgaagccagggcagagtcc
caggaagtgcctgccaccggaggcttaacttcctcctctgctctggtccccaccgtggaa
gtggctggcttgagtcccaggacgtccaggcgcatcctggaccgtgtggagaacaaccac
ttggtgcagagcgcacagaccctgctgctgagcccctgcacctcccgccgcctcactggc
ctcctggaccgtgaggttcaggctggccagcaggccctggctgccgcccagtgctcccgg
ggcccatgccctagccccagccccctcaccatccctgccattgtggtgggtgaggaagga
tctgctactggtgagggagaggattccagggagaggacctcccaggaaagtgacaaggct
ggactgctaggggaggtggacggacaaacagtagagagcagaacccaggagccctgccaa
gaagaagcaatcccaggggaggctttgacaggtctccctgcagctacacctgaggaactg
gctctaggggcccggaggaagaggttcctccctaaggtgagagcagggtcagacggtgag
gtgaacaaggctgaagaaagagagagtcccacagtctccccccggggacccaggaagggt
ctggcacctgggtcacccgggactccagggcgggagagacggtcccctacccaggcccgg
aaggccagcatgttagaggtgcctgggacagaagaagagcctgcatcgggagacttggtc
accagacccaaggccagtggtctggaatcagagcctgcggtggatgaaggcaagcaggaa
gcactggctaagccaaggaaagctaaagacctgttaaaagccccacaggtgatccggaaa
attcgggtagaacagtttccagattcttctggtagtctgaagctttggtgtcagtttttc
aatatcgttagcgactcagtcttgacatgggcgaaggatcagcatctagtgggcgaagtg
agcaggagtgcaggggacgaggggccagcggccttggccattgtgcaggcgtcacctacg
gactgtggcctgtatcgctgtaccatccaaaacgagcatggctccgcttccactgacttc
cgcctcagcccggaagtattgtctggcttcatctccagagaggaaggtgaagttggagaa
gagattgagatgacccccatggtatttgctaagggtctggctgactctggctgctggggg
gacaagctctttgggcgattggtgagcgaggagcttcgagggggtggacatggccttcag
aaggcttcgcgggccaaggtcatctatgggctggagcccatcttcgaatctggtcgcacg
tgcatcatcaaggtatccagcctgctcgtgttcggacccagcagtgagacttctcttctg
ggcagaaactatgacgtcactatccagggatgcaagatccagaacatgagtcgagagtac
tgcaaaatctttgcagctgaaacccgggcagcctctggcttcggggaggttcctgagatc
atcccactttacttgatctatcggcctgcaaacaatataccgtatgctaccctggaggaa
gatctgggcaagcccctgcagacttactgttccaggcagtggagctgtgctggggcccca
gcagcatccagcagcttggagcctgtgcagaaatgccaaaccttccagcactggctgtat
cagtggacgaacggcagcttccttgtcacagatctggcaggggctgactggaagatgact
gatgtagagatcgctaccaaactccgaggataccaaggcctcaaggagagctgttttcct
gccctgctggaccagtttgcctcttcccaccagtgcaacacctactgtgagatgctgggg
ctgaaacccctcaagggccctgagggtgcccaccctcaaaccaaggccaaaggctccaaa
agtccatctgctggcagaaaaggttcccagctgagtcctcagccccagaagaaaggtctt
cccagtcctcagggctccaggaagagcgctccaagctccagagccacgcctcaggcctcc
caggaggccactcttcagttactgggacagccccctgcccaagaggggagctctaaggcc
cagggcatgcggtag

DBGET integrated database retrieval system