KEGG   Rattus norvegicus (rat): 365299Help
Entry
365299            CDS       T01003                                 

Gene name
Bnc1
Definition
(RefSeq) basonuclin 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-DNA_Pol DUF1947
Motif
Other DBs
NCBI-GeneID: 365299
NCBI-ProteinID: NP_001102386
RGD: 1309042
Ensembl: ENSRNOG00000019770
UniProt: F1LUF8
Position
1q31
AA seq 990 aa AA seqDB search
MRRSPSRGGRGAARAGYARREGRPRSGRRMAEAIGCTLNCSCQSFKPGKINHRQCEQCRH
GWVAHALSKLRIPPVYPTSQVEIVQSNVVFDISSLMLYGTQAIPVRLKILLDRLFSVLKQ
DEVLQILHALDWTLQDYIRGYVLQDASGKVLDHWSIMTSEEEVATLQQFLRFGETKSIVE
LMAIQEKEEQSIVIPPATANVDIRAFIESCGHRSANLPTPVDKGNPSSMHPFENLISNMT
FMLPFQFFNPLPPALIGSLPEQYVLEQGQDQSRDPKQDLHGPFSDSGFLTSTPFQVEKEQ
CLSCPDAVTQKEDSAHLSDSSSYSIASKLERTQLSPEAKMKPERNSLSAKKGRVFCTACE
KTFYDKGTLKIHYNAVHLKIKHKCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMNRNNRD
KDLRNSLNLASSETYKRPGFTVMSPDCGPLPGYTGSVEDSKGQPAFSSIGQNGVLFPNLK
TVQPVLPFYRSPATPAELANTPGMLPSLPLISSSIPEQLVSTDVPFDALPKKKSRKSSMP
IKIEKEAVEIADEKRHSLSSDDDVPLQVVSEDEPEDSSPQSDRVPEEQRTQLGLEEPLPQ
GERACHLESVIEPHGAISRTLEQTTLTERESEQKVALSSVMPREVEHDGHERHFTPGLGP
QIPFPDYMELQQRLLAGGLFGALSNRGMAFPFLEESKELGHLSEHALVRQKEETRFQCDI
CKKTFKNACSMKTHEKSTHARETHACTVDGCGAAFLSRRSRDRHSSNLSLHQKVLNEEAL
ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPISQVHSASLES
YNSGPPSEGTILDLSTTSSMKSESSSHSSWDSDGVSEEGTALMEDSDGNCEGQSLVSAED
EYPICVLMEKADQSLASLPSGLPITCHLCQKIYSNKGTFRAHYKTVHLRQLHKCKVPGCN
TMFSSVRSRNRHSQNPNLHKSLASSPGHLQ
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggtcgccgagccggggcggacgcggagcggcccgggcagggtacgcgcgccgg
gaaggccggccccggagcggccgcaggatggctgaggctatcggctgtactctgaactgc
agttgccaaagcttcaaacctgggaagataaaccaccgccagtgtgaacagtgcaggcat
ggatgggtggctcatgctctaagtaagctgaggattccccccgtgtatccgacaagccaa
gtggaaattgtccagtccaatgtagtgtttgatattagcagccttatgctctatggaacc
caagctatccctgttcgcctgaaaatcctactggaccggctcttcagtgtgctgaagcaa
gatgaggttctacagatcctccatgccctggactggacacttcaggattacatccgtgga
tatgtgttacaggatgcctcagggaaggtgttggatcactggagcatcatgaccagtgag
gaggaagtggccaccttgcagcagttccttcgttttggagagaccaagtctatagttgag
ctcatggcaatccaagagaaagaagagcagtctatcgtcattccacctgccacagcaaac
gtagacatcagggctttcatcgagagctgcggccacaggagtgccaacctccccactccg
gtggacaaaggaaaccccagcagcatgcatccttttgagaaccttataagcaacatgacg
ttcatgttgcctttccagttcttcaaccctctgcctcctgctctgatagggtcgctgcct
gaacagtacgtgctggagcagggtcaggaccaaagccgggaccccaagcaggaccttcat
gggcccttttctgacagtggcttcttaacttccaccccgtttcaggttgaaaaggaacag
tgtctaagctgtccagacgctgtcacccagaaggaagacagtgcccacttaagtgactcc
agctcctacagcattgccagtaagctcgaaaggacacagctgtcccctgaggccaaaatg
aagcctgagaggaacagcctgagtgctaagaagggccgggtgttctgcaccgcatgcgag
aagacattctatgacaaaggcactctcaagatccactacaacgccgtccacctgaagatc
aagcataagtgcactatcgaagggtgtaacatggtgttcagctccctgaggagccggaac
cgacacagcgccaaccccaaccctcgcctgcacatgccaatgaacagaaacaaccgagac
aaagatctcaggaacagcctgaacctggcaagctccgagacctacaagcgcccaggtttc
acagtgatgtctccagactgtgggcccctccctggctacactggttcagtggaggactcc
aaaggccaaccagctttctcaagcattgggcaaaatggtgtgcttttccccaacctaaag
actgtccagccagtccttcctttctaccgcagtccagctactcccgcggaactggcaaac
acacccggcatgctgccttctctccctctgatctcctcctcaatcccagaacagctggtt
tccacagacgtgccatttgatgctcttcccaagaagaagtcccggaagtccagtatgccc
atcaagatagagaaagaagctgtggaaatagctgatgagaagagacacagtctcagctca
gatgatgacgtgcccctgcaggtagtcagtgaagatgagccagaggacagcagtcctcag
tcagacagagtgcctgaggagcagcgtacacagctaggcttagaggagcctcttccacag
ggagaaagagcctgccatcttgaatctgtgattgagccgcatggagctatcagcagaacc
cttgagcagaccacgctcactgagagggagtctgaacagaaggtcgcactgagttcagtg
atgccaagagaggtggagcatgatggtcacgagcgacatttcacccctggcctggggccc
caaatcccttttcctgactatatggaattgcagcagcgcctgctggctgggggactcttt
ggtgctttgtccaacagggggatggcttttccttttctggaagagtctaaagaactggga
cacctgagtgaacatgcactagtgaggcagaaggaagaaactcgctttcagtgtgacatt
tgcaagaagacctttaaaaacgcttgcagcatgaagacacacgagaagagtacacatgcc
agagagacacatgcgtgcacggtggacggctgcggggctgctttcctttccaggaggagc
agagacagacacagctcgaacctaagcctccaccagaaagtattgaatgaagaagcgttg
gagaccagtgaggaccattttcgtgcagcttaccttcttcaagatgtggccaaggaggcc
tatcaggatgtggctttcacaccacaagcctcacagacatctgtcatcttcaagggaaca
agcggcatgggcagtctggtttacccaatatcccaagttcacagtgccagcctggagagc
tacaactctgggccccctagcgagggcaccatcctggatttgagcactacctcaagtatg
aagtcagagagcagcagtcattcctcctgggactctgacggggtgagcgaggaaggtacc
gcccttatggaggacagtgatggcaactgtgaaggacagagccttgtctctgcagaagat
gagtaccccatctgtgtcctgatggagaaggccgaccagagccttgctagtctgccctct
ggtttgccaataacctgtcatctctgccaaaagatatacagtaacaaagggaccttcaga
gcccattacaaaaccgtgcacctccgccagctccataagtgcaaagtaccaggctgcaac
acgatgttttcatctgtccgcagtagaaacagacacagtcagaatcccaacctgcacaag
agcctggcttcatctccaggccacctccagtaa

DBGET integrated database retrieval system