KEGG   Rattus norvegicus (rat): 365337
Entry
365337            CDS       T01003                                 

Gene name
Olr202
Definition
(RefSeq) olfactory receptor 202
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    365337 (Olr202)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    365337 (Olr202)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    365337 (Olr202)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 365337
NCBI-ProteinID: NP_001000550
RGD: 1332958
Ensembl: ENSRNOG00000025819
UniProt: D3ZST9
Position
1q32
AA seq 322 aa
MIHSNISIIHPAVFVLLGIPGLETYHIWLSIPLCLMYVTAVLGNSILIMVIITERNLHEP
MYFFLSMLAITDILLSTTTVPKALAIFWFHAHNIAFDACVTQVFFVHTMFVGESAILLAM
AFDRFVAICAPLRYATVLTWPTVGRMALAIVIRSVCIIFPVIFLLKRLPFCRTNIVPHSY
CEHIGVARLACADITVNIWYGFSVPIVMVIVDVILIAVSYSLILRAVFRLPSQDARHKAL
STCGSHLCVILMFYVPSFFTLLTHRFGRNIPRHVHILLANLYVVVPPMLNPIVYGVKTKQ
IREGVVHWFLDIKTQCCSLPLG
NT seq 969 nt   +upstreamnt  +downstreamnt
atgattcacagcaatatcagcatcatccaccctgcagtttttgtgctacttggcatccct
gggttggagacttatcacatctggctgtctatacccctgtgcctcatgtatgtcactgca
gtcctcggaaacagcatcttgataatggtcatcatcacagaacggaaccttcatgaaccc
atgtattttttcctctccatgttggccatcacagacatcttactgtccaccactactgta
cccaaggccctcgctatcttttggttccatgcccacaacattgcctttgatgcctgtgtc
acccaagtcttctttgtgcatacaatgtttgtgggggagtcagccatcttgttagccatg
gcctttgaccgctttgtagctatctgtgccccactgagatatgcaacagtgctaacctgg
cccacagttgggaggatggctctagccattgtcatcagaagcgtctgtattatctttcct
gtgattttcttgctcaagcggctgccattctgcagaaccaacattgtcccccattcctac
tgtgagcacattggggtggcccgcttagcttgtgccgacatcaccgttaacatttggtac
ggcttctcagtgcctatcgtcatggtcatcgtggatgtgatcctcattgctgtgtcatac
tcgctcatcctccgagcggtgtttcgtttgccctcccaggatgctcggcacaaagctctc
agcacctgtggctcgcatctctgcgtcatcctcatgttttacgttccgtccttctttact
ttactgacccaccgctttgggagaaacattccccgacatgtgcatatcctgctggccaat
ctttatgtggtggtgcctccaatgctgaaccccattgtctacggagtgaagactaagcag
atccgggagggtgtggtccactggttcttggacattaagactcagtgttgttccttgcct
ttgggatga

DBGET integrated database retrieval system