KEGG   Rattus norvegicus (rat): 365377Help
Entry
365377            CDS       T01003                                 

Gene name
Trim72, RGD1562778
Definition
(RefSeq) tripartite motif containing 72
  KO
K12036  tripartite motif-containing protein 72
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    365377 (Trim72)
   04121 Ubiquitin system [BR:rno04121]
    365377 (Trim72)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Others
   Others
    365377 (Trim72)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    365377 (Trim72)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_UBOX zf-C3HC4_4 PRY zf-B_box SPRY zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-RING_5 zf-C3HC4_3 zf-Nse K-box Spc7
Motif
Other DBs
NCBI-GeneID: 365377
NCBI-ProteinID: NP_001071143
RGD: 1562778
Ensembl: ENSRNOG00000022099
UniProt: A0JPQ4
Position
1q37
AA seq 477 aa AA seqDB search
MSTAPGLLRQELSCPLCLQLFDAPVTAECGHSFCRACLIRVAGEPADDGTVACPCCQAST
RPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRTLVCGVCASLGSHRGHRLL
PAAEAHARLKTQLPQQKAQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMR
MFLAALESSLDREAERVRGEAGVALRRELSSLNSYLEQLRQMEKVLEEVADKPQTEFLMK
FCLVTSRLQKILSESPPPARLDIQLPVISDDFKFQVWKKMFRALMPELEELTFDPSSAHP
SLVVSASGRRVECSEQKAPPAGEDTCQFDKTVAVVAKQLLSQGEHYWEVEVGDKPRWALG
VMAADASRRGRLHAVPSQGLWLLGLRDGKILEAHVEAKEPRALRTPERPPARIGLYLSFA
DGVLTFYDASNTDALTPLFSFHERLPGPVYPMFDVCWHDKGKNSQPLLLVGPDSEQA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgcaccaggccttttgcgccaggaactgtcttgcccgctgtgcttgcagctg
ttcgatgcaccagtgaccgctgagtgtggccacagtttctgccgtgcctgcctgatccgt
gtggcaggggagcctgccgacgatggcacggttgcctgtccctgttgtcaggcatctact
cggccacaggcgctaagcactaacctccagttggcacgccttgtggagggtttggcacaa
gtgccccaaggccactgcgaggaacacctggatccactgagcatctactgcgagcaggac
cgcacacttgtgtgtggtgtgtgtgcctctctcggttcacaccgtggtcaccgtcttctg
cctgccgcagaagcccatgcacgtctcaagacacagcttccacaacagaaggcccagctg
caggaggcatgcatgcgcaaggagaagagtgtagcagtcctggagcatcagctggtggag
gtggaggagaccgtgcgtcagttccggggagctgttggggagcagctggggaagatgcgg
atgttcctggctgccctagaaagttctttggaccgtgaagcagaaagggttcgaggtgag
gcaggggttgccttgcggcgggagctgtcaagcctgaactcttacctggagcaactgagg
cagatggagaaggtgctggaggaggtggctgacaagccacagacagaattcctcatgaaa
ttctgcctggtgaccagcaggctgcagaagattctgtcagagtcaccacccccagcaagg
ctagatatccagctgcctgtcatctcagatgacttcaaattccaggtgtggaagaagatg
ttccgggctctgatgccagagttggaggaactgacttttgaccccagctctgcgcacccg
agcctggtggtgtccgcctctggtcgccgagtggagtgctcggagcagaaggcgccgcca
gcaggagaagacacgtgccagttcgacaagacggtagcggtagtggcgaagcagctgctg
tcacagggggagcactactgggaggtggaggtgggcgacaagccacgctgggccctgggt
gtgatggcggctgacgcttcccgtcgtggccgcctgcacgcggtgccctcacaggggctg
tggttgctcggcctgcgcgatggcaagatcctggaggcacacgtggaggccaaggagcca
cgggcactgcgcaccccagagaggccaccagcgcgcattggcctctacctaagctttgca
gatggcgtcctgactttctatgatgcaagcaacaccgacgcgcttacaccgctcttttct
tttcatgagcgtctgcctgggccggtgtaccccatgtttgacgtgtgctggcacgacaag
ggcaagaattctcagccgctgttgctcgtggggccagacagtgagcaggcctga

DBGET integrated database retrieval system