KEGG   Rattus norvegicus (rat): 365389
Entry
365389            CDS       T01003                                 

Gene name
Lrrc56, RGD1311654
Definition
(RefSeq) leucine rich repeat containing 56
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LRR_4 LRR_8 LRR_9
Other DBs
NCBI-GeneID: 365389
NCBI-ProteinID: NP_001020073
RGD: 1311654
Ensembl: ENSRNOG00000016697
UniProt: Q4V8C9
Position
1q41
AA seq 548 aa
MDPAWDGSQGSRPGTASIRVRELSWQGLNNPQPQNKRLGSHGDIYRERRVEEHLSPARLQ
ALAQVDDLQLVRVLEMCVDTRKNSLGNFGMHLPNLIQLKLNHSCLGSLRDLGTSLGQLQV
LWLARCGLTDLDGIGSFLALKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQMRY
LQLCPRLTTLTLEGNLVCLKPDPGPSNKAPQDYNYRAEVKKLIPQLHILDEVPTTCTNLP
APQKLSQDWLMVKEAIKEGNVLDILLPRLECSHGATIRKFDPTLPVPETQPWALSLLVPE
GPLPEGLLSENPAAEDHASNLTHGPGQVLCGNPTKGLRERRNQYQEWAPLEQLPPHRPDL
AIRPSTLRPDPAESCDLSMTGLRAWREPGLRPLLQRQLEFQQERLTHVQAQDPQKAPIEQ
EDQTGPKTSLTPLRLASELSRTSGFHLIPSPPKYPMPPESGISSLGRSADLPFRGRRLRV
LGSLGPSLGEGSVLGERLALRALEVSSDPSHRAQGCPDPKPSLGPATCPLGLHCLHHLNP
IPPAHPFP
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggacccagcctgggatggatcccaggggtctcgaccaggcacagctagtatccgggta
cgggagctgagctggcagggcctaaacaacccccaaccacaaaacaagagactgggcagc
catggggatatctacagggagcggcgggtggaggagcatctatcccctgcacgactgcag
gccctggcccaggtagatgacctccaactggtgagggtcctggagatgtgtgtggacacc
cgtaagaacagcctggggaacttcggaatgcaccttcctaacctgatccaactgaagctg
aaccacagctgcctgggctccctcagagacctgggcacttctctgggccaactgcaggtg
ctgtggctggctcgctgtggcctgactgacttggatggcattggctccttcttggcactg
aaggaactttatgtctcctacaacaacatctcggacctgagcccactgtgtctgctggag
cagctggaggtgctggaccttgagggcaacaatgtggaggacctggggcagatgcggtac
ctacagctgtgcccacgcttgaccacgcttacattggaggggaatctagtgtgcctgaag
ccagaccctggcccttctaacaaggcacctcaggactacaactacagagcagaggtaaag
aagctcatcccccagctccatatcctagatgaggtacccaccacatgcaccaacttgcct
gctccccagaagctgagccaggactggctgatggtgaaggaggccatcaaggaaggcaac
gtgcttgacattctcctgcctcggctggagtgttcccatggagccaccattcggaaattt
gacccaaccttgcctgtgcctgagacccagccatgggccttgtccctgctggtccctgag
ggccccttgcctgaaggtctgctttctgagaacccagccgcagaagaccatgccagcaac
ctcacccatggtcctggtcaagttctctgtgggaaccccaccaaaggcctacgggaacgt
agaaaccagtaccaggaatgggcacccctggaacagctgcccccacataggccagatctg
gccatcagaccctccaccctaaggcctgaccctgcagaaagctgtgacctgtcaatgact
gggcttcgggcctggagggaacctggcctgcgtcctcttctccaaagacagctggagttc
caacaggaaagacttactcatgtccaggcccaggacccacagaaggctcctatagaacag
gaagaccagactggacccaagacttccctaaccccgctacgcctggcctcagaactttcc
aggacatcaggctttcacttgatcccttctcccccaaagtacccaatgccacctgagtca
ggcatcagttccttggggagatctgcagacctacccttcagaggacgtaggctgagagtc
ctgggcagcttggggcctagcctgggtgaggggtctgtcctgggtgagaggttggccttg
agagccctggaggtgtcctcagaccccagccatcgagcccagggatgtccagatcccaag
ccatcactaggcccggcaacttgtcctctagggctccactgcctccatcacctgaaccct
atccctccagcccatcctttcccttag

DBGET integrated database retrieval system