KEGG   Rattus norvegicus (rat): 365390Help
Entry
365390            CDS       T01003                                 

Gene name
Tspan32, Phemx
Definition
(RefSeq) tetraspanin 32
  KO
K17359  tetraspanin-32
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    365390 (Tspan32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin DUF1772 ABC2_membrane_2
Motif
Other DBs
NCBI-GeneID: 365390
NCBI-ProteinID: XP_002725803
RGD: 1308721
Ensembl: ENSRNOG00000026039
UniProt: F7F785
Position
1q41
AA seq 252 aa AA seqDB search
MGHWNRIKIAKCQILITNFFVLLLGLSLATMTVVTHFGDHFTVIGHASLQRNPYETLRYW
AFYVGISLAGLLSLGAALSTIATVREAHGLMAAGFLCFALSFCILVQVAFWRFHNPTQVE
DAVLDTYDLVYDQAMKSPSSSWWQELAVIQDTFLCCGKKSPFGLLASTGPIMCQGQKAMR
EDCLQSIRNFLWTHYRIASTLTCTSLALTVYAMMLCAFLWFAIHSYCGLDRRGRYSLTPR
SHGCQPQEPSLF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggggcactggaatcgaatcaagattgccaaatgccagatactgatcaccaacttcttt
gtcttgctgctgggcctctctctggccaccatgacagttgttactcactttggagaccac
tttactgtaattggccatgcatccttgcagaggaacccctatgaaacactgcgctattgg
gctttctatgtggggatcagcctagcagggctactgagcctcggagctgctctgagcacc
atagccactgtgagggaggcccatggcctcatggctgcgggattcctgtgctttgctctg
tcattctgcatcctggtgcaggtggccttctggagattccacaaccccacccaggtggag
gatgcagtgttggatacctatgacctcgtgtatgatcaggcaatgaagagcccatctagc
agctggtggcaggagctggccgtcatccaggacacgtttctgtgttgtggtaagaaatct
ccttttgggcttctggcgagcactggacccatcatgtgtcagggccagaaggccatgaga
gaggactgcctccagagcatcaggaactttctgtggacacactaccgtatcgcttccacc
ctgacctgcaccagcctggccctcacggtatatgctatgatgctctgtgccttcctctgg
tttgccattcactcctactgtggcttggatcgaagaggcagatactccctgaccccacgg
tcccatggctgccagccccaggaacccagcctcttctga

DBGET integrated database retrieval system