KEGG   Rattus norvegicus (rat): 365394Help
Entry
365394            CDS       T01003                                 

Gene name
Cabp4
Definition
(RefSeq) calcium binding protein 4
  KO
K23531  calcium-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    365394 (Cabp4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    365394 (Cabp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_9 SPARC_Ca_bdg EF-hand_4 Presenilin Apt1 DUF4551 Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 365394
NCBI-ProteinID: NP_001102396
RGD: 1306083
Ensembl: ENSRNOG00000022044
UniProt: D3ZY59
Position
1q43
AA seq 271 aa AA seqDB search
MATEHSAQLAPAPQKIPKGAVPPRSAAEDPALTRRRSKKENWHPGTQKASSEEQSFSQSS
EASGSSKNSSRTKVGQEEPSSAPTRQASHRQSHRHRSDPQQDAAQRTYGPLLNRMFGKDR
ELGPEELEELQAAFEEFDTDQDGYIGHRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGF
VDFEEFVELISPKLREETAHMLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLE
GTELDEMLRDMDLNGDGTIDFDEFVMMLSTG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagagcacagtgcacagctggctcctgccccccagaagatccctaaaggagct
gttcctccaaggagtgctgctgaagaccctgccttgaccaggagaagaagcaagaaggag
aattggcacccagggacccagaaagccagttctgaggaacagtcctttagccagagctct
gaggcctcaggaagcagcaagaactcctcaaggaccaaagtggggcaggaggaaccatcc
tcagcacctacccggcaagcctctcaccgacagtcccaccgacaccgttctgaccctcaa
caggatgctgcccaaaggacttatgggcccctgctcaaccgcatgtttggaaaggaccgt
gagctgggccctgaggagttggaagagctccaggctgcctttgaggagtttgacactgac
caggatggctacatcggccaccgggaactaggtgactgcatgcggactctgggctacatg
cccacggagatggagctgctcgaagtgtcccagcacgtgaagatgcgcatggggggcttt
gtggattttgaagagtttgtggaactgataagccccaaactgagggaggagacagctcac
atgctgggtgtgcgggagctgcggatcgccttccgagagtttgacaaggacagagatgga
cggatcacagtggcggagctgcggcaggcagcacccgctctgctgggggaaccactagag
ggcactgaactggatgagatgttgagagacatggacctcaatggcgatggcactatagac
tttgacgagtttgtaatgatgctatctacaggctga

DBGET integrated database retrieval system