KEGG   Rattus norvegicus (rat): 365396Help
Entry
365396            CDS       T01003                                 

Gene name
Ssh3
Definition
(RefSeq) slingshot protein phosphatase 3
  KO
K05766  protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    365396 (Ssh3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    365396 (Ssh3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    365396 (Ssh3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     365396 (Ssh3)
    3.1.3.48  protein-tyrosine-phosphatase
     365396 (Ssh3)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    365396 (Ssh3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc DEK_C Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 365396
NCBI-ProteinID: NP_001012217
RGD: 1308679
Ensembl: ENSRNOG00000018878
UniProt: Q5XIS1
Position
1q43
AA seq 652 aa AA seqDB search
MALVTVSRSPPASGHSTPVGPTDRVIRRRGRLQRRQSFAVLRGAVLGLQDGGEGNDAAEA
DPEPMEKPSGEEQPAEDQTDNGQGSQSPWKQVQKRHLHLMVELLRPQDDIRLAAQLEAAR
PPRLRYLLVVSTGEGLSEEETILLGVDFPDSSSHSCTLGLVLPLWSDTQVYLDGDGGFSV
TSGGQSRIFKPVSIQTMWATLQVLHQACEVALGSGLVPGGSALAWATHYQEKLNSDQGCL
NEWMAMSDLESFRPPNAEPGQASEQEQMEQAILAELWQVLDASDLDSVTSKEIRQALELR
LGCPLQQYRDFIDNQMLLLMAQQDRASRIFPHLYLGSEWNAANLEELQRNRVSHILNMAR
EIDNFFPERFTYHNVRVWDEESAQLLPHWKETHRFIEDARAQGTRVLVHCKMGVSRSAAT
VLAYAMKQYGWGLEQALIHVQELRPIVRPNPGFLRQLQTYQGILTASRQSHVWEQKVGVV
SPEEPLAPEVSTPLPPLPPEPGGSGEGMVMGQKGSQETPKEELGLRPRINLRGVMRSISL
LEPSSEPESTTEAGDLPEVFSSDEEPLHPFSQLSRAKGGQRVCKGPWPALKSRQSVVALH
SAALVASRARAFQGQGQGQGQEQRETGTSSTPRLRKVIRQASVDDSREEGKA
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggtcacagtgagtcgctcgccaccggcaagtggccactccacgcctgtggga
cccacggaccgagtgataagacgcagaggccggctccaacgcaggcagagttttgctgtt
ctccgaggggctgtcctgggacttcaggatggaggggaagggaatgatgcagctgaggct
gaccctgagccaatggagaagccctcaggtgaggagcagcccgctgaggaccagactgac
aacgggcaagggtcccagagtccctggaaacaagtgcagaagcggcacctgcaccttatg
gtggagctgctgaggccacaggatgatatccgcctggcagcccagctggaggcagcccga
cccccaaggcttcgctatctgctggtagtgtccacaggagagggtctgagtgaggaggag
accatccttcttggggtggacttccctgacagcagttcccacagctgcaccctgggcctg
gtcttgcccctctggagtgatacccaggtgtacctggatggtgatgggggcttcagtgtg
acatctggtggtcagagccgaatcttcaagcctgtctctatccagaccatgtgggccaca
ctgcaggtattgcaccaggcatgtgaggtggctctaggcagtggccttgtgcctggtggc
agtgcccttgcctgggccactcactaccaggagaaactgaactctgaccagggttgcctc
aatgagtggatggccatgtctgacctggagtcctttcgaccacctaatgctgagcctgga
caggcttcagaacaagagcagatggaacaggcaatcttggctgaattgtggcaggtgttg
gatgccagtgacctggacagtgttacgtctaaagagatccgtcaggccctggagctgcgt
ctaggatgccctctccagcagtaccgtgactttattgacaaccagatgctgctgctcatg
gcccagcaagaccgggcctcccgcatcttcccccacctctacttgggttctgaatggaat
gctgccaacctggaggaacttcagagaaacagggtaagtcacatcctgaacatggcccgg
gagattgacaacttcttccccgaacgattcacctatcacaatgtacgtgtctgggacgaa
gagtcagcacagctgctaccccactggaaggagacacatcgattcattgaggatgccaga
gcacagggcactcgggtgctagtccactgtaagatgggcgtcagccgttctgctgccacg
gtactggcctatgccatgaaacagtatggctggggcctcgagcaagccctgatccacgtg
caggagctccggcccattgtacgccccaaccctggcttcctgcgccagctacagacctac
cagggcattctgactgccagccggcagagccacgtctgggagcagaaagtgggtgtggtc
tccccagaggagcccttggcacctgaagtttctacaccattgccacctcttccaccagaa
ccagggggcagtggagaggggatggttatgggccagaaaggaagccaggaaaccccaaaa
gaagagcttggactgcggccccgcatcaacctccggggggtcatgcgctccatcagtctt
ctggagccctcctcagagccagagagtaccacagaggctggagacctgccagaagttttc
tcttctgatgaagaacctcttcatcccttctctcagctttcaagagccaaaggtggccag
cgggtctgcaagggaccttggcctgccctgaagtctcgacagtctgtggttgcccttcat
agtgctgccctggtggctagcagggcacgagccttccaggggcaagggcaagggcagggc
caagagcagagggagactggtacatcttctacacctaggctccggaaggtgataaggcag
gccagtgtagatgacagcagggaggagggcaaggcctga

DBGET integrated database retrieval system