KEGG   Rattus norvegicus (rat): 365398Help
Entry
365398            CDS       T01003                                 

Gene name
Slc22a12, Rst, Slc22al2
Definition
(RefSeq) solute carrier family 22 member 12
  KO
K08208  MFS transporter, OCT family, solute carrier family 22 (organic anion/cation transporter), member 12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    365398 (Slc22a12)
   04147 Exosome [BR:rno04147]
    365398 (Slc22a12)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   365398 (Slc22a12)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    365398 (Slc22a12)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   365398 (Slc22a12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 365398
NCBI-ProteinID: NP_001030115
RGD: 621628
Ensembl: ENSRNOG00000021108
Vega: OTTRNOG00000002165
UniProt: Q3ZAV1
Position
1q43
AA seq 553 aa AA seqDB search
MAFPELLDRVGGRGRFQLLQAVALVTPILWVTTQNMLENFSAAVPHHRCWVPLLDNSTSQ
ASIPGDFGRDVLLAVSIPPGPDQRPHQCLRFRQPQWQLIESNTTATNWSDADTEPCEDGW
VYDHSTFRSTIVTTWDLVCDSQALRPMAQSIFLAGILVGAAVCGHASDRFGRRRVLTWSY
LLVSVSGTIAALMPTFPLYCLFRFLVASAVAGVMMNTASLLMEWTSAQAGPLMMTLNALG
FSFGQVLTGSVAYGVRSWRMLQLAVSAPFFLFFVYSWWLPESARWLITVGRLDQSLRELQ
RVAAVNRRKAEADTLTVEVLRSAMQEEPNGNQAGARLGTLLHTPGLRLRTFISMLCWFAF
GFTFYGLALDLQALGSNIFLLQALIGIVDLPVKMGSLLLLSRLGRRLCQASSLVLPGLCI
LANILVPREMGILRSSLAVLGLGSLGAAFTCVTIFSSELFPTVIRMTAVGLGQVAARGGA
MLGPLVRLLGVYGSWLPLLVYGVVPVLSGLAALLLPETKNLPLPDTIQDIQKQSVKKVTH
DIAGGSVLKSARL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcctgaactcctggaccgagtagggggccggggcaggttccagctcctccag
gcagtggctctggtgacccccattttgtgggtcaccacccagaacatgctggagaacttc
tcagccgcagttccccaccaccgctgttgggtgcctcttctggacaacagcacctcccag
gcgagtatccctggggactttggacgagacgttcttctggccgtctccatcccacctggt
ccggatcagcgaccccaccagtgcctccgcttccgacaacctcagtggcagcttatagag
tccaacaccacggccaccaactggagcgacgctgacaccgagccatgtgaggatggctgg
gtttacgaccacagtaccttcaggtccacaattgtgaccacgtgggacctggtatgtgat
tcccaggctctgagacccatggcccagtccatcttcctggctggaatcctggtaggagcc
gcagtgtgcggccatgcctcagataggtttgggcgcagaagggtgctgacctggagctat
cttctggtgtctgtgtctggcacaatagctgccctcatgcccaccttccccctctactgc
ctgttccgtttcctggtggcctctgcagtggcaggtgtcatgatgaacacagccagcctc
ttgatggagtggacatcagcccaggctggccccttgatgatgaccttgaacgccttgggc
ttcagctttgggcaggtcctgacaggctctgtggcctacggcgtgcgcagctggaggatg
ctgcagttggctgtctctgcccccttcttcctcttctttgtttactcatggtggctgcca
gaatcagcacgctggctcatcacagtgggcagactggaccagagcctgcgggaactacag
agggtggctgctgtcaacaggagaaaggcagaggcagacacgttgactgtggaggtcctg
cggtcagccatgcaggaggaaccgaacgggaaccaagctggtgcccgtttgggcactcta
ctccacacacctgggctgcgcctccgaaccttcatctccatgctgtgctggtttgccttt
ggcttcaccttctatggcctggcccttgacctgcaagccctaggaagcaatatcttcctg
ctccaggcactcatcgggattgtggacctcccggtgaagatgggcagcctgctgctgctc
agccgcttgggccggcgcctctgccaggccagctccctggtgctgccgggactctgcatc
ctggccaacatactggtgccccgtgagatggggatccttcgctcatccttggctgtgctg
gggctggggtccctgggggctgccttcacctgtgtcaccatattcagcagtgaactcttc
cccactgtgatcaggatgactgcagtgggcctgggccaggtagcagcccgaggaggagcc
atgctagggcctttggtgcggctgctgggtgtctatggctcctggctgcctctgctggtg
tatggagtggtgccagtgttaagcggcctagctgcattgctgctgcctgagaccaagaac
ttgccactgcctgacaccatccaagacatccagaaacagtcagtgaagaaagtgacacat
gacatagcaggcggctccgtcctgaagtctgcccggttgtaa

DBGET integrated database retrieval system