KEGG   Rattus norvegicus (rat): 365410
Entry
365410            CDS       T01003                                 

Gene name
Osbp
Definition
(RefSeq) oxysterol binding protein
  KO
K20456  oxysterol-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    365410 (Osbp)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    365410 (Osbp)
SSDB
Motif
Pfam: Oxysterol_BP PH_8 PH PH_6 Syntaxin-6_N Pterin_4a HlyD_D23
Other DBs
NCBI-GeneID: 365410
NCBI-ProteinID: NP_001102397
RGD: 1308069
Ensembl: ENSRNOG00000021057
UniProt: D4A9D8
Position
1q43
AA seq 682 aa
MRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVK
MLAESDESGDEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESL
KLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLE
ETLEQLAKQHNHLERAFRGATVLPANTPGSTGSGKEQCCSGKGDMSDEDDENEFFDAPEI
ITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKN
CIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYS
TTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKI
TSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKT
GDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQPASGENGGD
ARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLME
NGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVTKELTH
VYRGEYWECKEKQDWGSCPDIF
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgaggcacacctgccgaggcaccatcaaccttgccacagccaacatcactgtggaagac
tcttgcaacttcatcatttccaatggcggtgctcagacctaccacttgaaggccagctcg
gaagtggagcgtcagcgctgggtgacagccctagaactggccaaggccaaggctgtgaag
atgctggctgagtcagatgaatcaggagatgaggagtctgtctcacaaactgacaagact
gagctccagaataccctccggacactctccagcaaagtggaggacctgagcacgtgcaat
gacttgatagctaaacatggcaccgccctgcagcgttccctcagcgagctggagtctctg
aagctgcctgctgagagcaatgagaaaatcaaacaggtcaatgaacgagccacactcttt
aggataacatccaatgccatgatcaatgcctgcagagatttcctcatgttagcccagacg
catagtaagaagtggcagaagtccctgcagtatgaacgggaccagcgtatccgactggaa
gaaactcttgagcagctggcgaagcagcacaatcacctggagagagccttccggggagcc
acagtgctgccagcaaacactccgggcagcactgggtctggtaaagagcagtgctgttct
ggcaaaggggacatgagcgatgaagatgacgagaacgaattctttgacgcaccagagatt
atcaccatgcctgaaaacttgggccacaaacgtactggtagcaatatcagtggagccagc
agtgacatcagccttgatgaacagtacaagcatcagctggaggagaccaagaaggaaaag
agaaccagaataccatataagccaaactacagcctcaacttgtggagcatcatgaagaac
tgcattggaaaagagctctctaagatcccaatgccggtaaactttaatgagcccttgtcc
atgcttcagcgccttactgaagatctggaataccatgagctgttagaccgagctgccaag
tgtgagaactctctagaacagctctgctatgtggcagccttcaccgtttcctcctattcc
actactgtcttccgaaccagcaagccattcaaccctctccttggggagacatttgaacta
gaccgactggaggagaatgggtatcgatccctctgtgagcaggtgagtcatcatccccct
gctgctgcgcaccatgctgaatccaaaaatggctggacattgcgtcaggaaattaaaatc
accagcaagtttcgaggcaaatacctctccattatgccccttggtaccatccactgcatt
ttccacgcaactgggcaccattacacttggaaaaaagttaccacaacagtacacaacatt
attgtgggcaagttgtggatagatcagtctggtgagattgacattgtaaatcacaagaca
ggagacaagtgtaatcttaaatttgttccttatagctacttctctcgggatgtagcaaga
aaggtgacaggtgaagtgacagacccatcaggaaaagttcactttgccctcctggggaca
tgggatgagaaaatggattgtttcaaagtacaaccagcctctggggaaaatggaggtgat
gctcggcagagaggccatgaagcagaagaaagtagggtcatgctatggaagaggaatcca
ttaccgaagaatgcagaaaacatgtactacttctcagagcttgcgctcactctcaatgcc
tgggaaggtggcactgctcctacagacagccggctgcggcctgaccagagactgatggaa
aatgggcgctgggatgaagcaaatgctgagaagcagcgtctggaggaaaaacagcgactt
tctaggaagaagagagaagcagaagctatgaaagccacagaagatggcacaccatatgac
ccctataaagcactgtggtttgagcggaagaaggaccctgtcaccaaggagctaacccat
gtttataggggcgagtactgggaatgtaaggaaaagcaggactggggttcttgcccagac
attttctga

DBGET integrated database retrieval system