KEGG   Rattus norvegicus (rat): 365468Help
Entry
365468            CDS       T01003                                 

Gene name
Lzts2, Lapser1
Definition
(RefSeq) leucine zipper tumor suppressor 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Fez1 DUF1127
Motif
Other DBs
NCBI-GeneID: 365468
NCBI-ProteinID: NP_001014269
RGD: 1359249
Ensembl: ENSRNOG00000014969
UniProt: Q3LUD4 Q5XIU0 F7FLS6
Position
1q54
AA seq 670 aa AA seqDB search
MAIVHTLPVPLEPARETATAPQTPAMGSVSSLISGRPCPGGPAPQRHHGVPGPTFFRQQD
GLLRGGYEAQEPLCPAVPPRKTVPGNSFTYVNEDFRTESPPSPSSDVEDPREHQAHNAHL
RGPPPKLIPVSGRLEKNMEKILIRPTAFKPVLPKPRGAPSLPGFLGPRAAGLSGSQGSLT
QLFGGPASSSSSSSSSSATDKPLALSGWASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTA
NSPGGHLPSHGPGRGPLPGPARGVPTGPSHSDSGRSSSSKSTGSLGARVAGGLLGSGARA
SPGSSSGGDRSPPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSVDESEAAVCQAFG
ARQRRWPGEREDCASHAQQATQRVQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQLE
RRCATFEREQQELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVALR
EARAALRVSEGRARGLQEAARARELELEACSQELQRYRQEAEQLREKARHLDAEAAGLRE
PPVPPATTDPFLLAESDEAKVQRAAAGTGGSLRAQVERLRQELQREQRRGDEQRNSFEGE
RLAWQAEKEQVIRYQKQLQHNYVQMYRRNRQLEQELQQLSLELEARELADLGLSEPAPCI
CLEEITATEI
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggccattgtgcacactctgccagtgccactggagcccgcacgtgagacagccactgcc
ccacaaactccagcaatgggcagcgtgagcagtcttatctcaggccggccctgtcctggg
ggacctgctcctcaacgccaccatggtgtccctgggcctaccttcttccgccagcaggat
gggctgctccggggtggctatgaggcccaggaaccactctgcccagctgtgccacccagg
aagactgtcccaggcaacagctttacctatgtcaatgaggacttccggacagagtcacct
cccagcccaagcagtgatgtcgaagatccccgagaacatcaggcacacaatgcccacctc
cgtgggcccccaccaaagctcatccctgtctctggaaggctggagaagaatatggagaag
atcctgatccgaccaacagccttcaagccagtgctacccaaacctcgaggggcgccatcc
ctacctggcttccttggtcctcgagctgctgggctatctgggagccagggcagcctgaca
cagctgtttggggggccagcctcttcctcctcctcttcctcttcctcctctgctactgac
aaacccttggcactcagcggttgggccagtggctgcccttcaggaacactgtcagactct
ggccgaaattctttatcaagcttgcccacctacagcaccggaggtgccgagccaactgcc
aactccccaggtgggcacctgccctcccacggccctggccgagggccactgcctggtcca
gcccgaggggtccctactgggccctcccattcagacagtggccggtcctcctccagcaaa
agcacaggttccttgggggctcgtgtagctggggggctcttgggcagtggggcccgggcc
tcccctggcagcagttcgggtggagaccgctccccaccccctccaccacctccaccccct
tcggatgaggccttgctacactgtgtcctggaagggaagcttcgagaccgagaggcagag
ctgcagcagctgcgggacagtgtggatgagagtgaggccgccgtgtgtcaggcattcggg
gcacggcagcggcgctggccaggagaacgagaggactgtgcctctcacgcacagcaggcc
acacagcgtgtccagcgggctcaacagctgctacaactgcaagtgttccagctgcagcaa
gagaagcgccagttgcaggatgacttcgcccagctgctgcaggagcgagagcagctggag
cgccgctgtgctacttttgaaagggagcagcaggaacttgggccacggctagaggagacc
aaatgggaggtgtgtcagaaatcaggtgagatctcccttctgaagcagcaactgaaggaa
tctcaggcagagctggtccagaagggtagtgagctggtggcgctgcgggtggcccttcga
gaggcccgggctgccttgcgggtcagtgagggccgtgcccggggcctgcaggaggcagcc
cgagctcgggagctggagctggaggcctgctcacaggagctacagcggtaccgccaggag
gctgagcagctccgggagaaggctaggcatttggatgctgaagcagcaggactccgggag
ccccctgtacccccggctaccaccgacccgttcctcctggcggagagtgatgaggctaag
gtgcagcgggcagccgctgggacagggggtagcctgcgggctcaggtggaacggttgcgc
caagaactgcagcgggagcagcggcggggagatgaacaacggaacagctttgagggggag
cggctggcctggcaggcggagaaggaacaggtgatccgctaccagaagcagctgcagcac
aactatgtccagatgtaccggcgtaaccgacagctggagcaggaactgcagcaactgagc
ctagagctggaggcccgggagcttgctgatttgggcttgtcggagccggccccttgcatc
tgtctggaggagatcactgccactgaaatctag

DBGET integrated database retrieval system