KEGG   Rattus norvegicus (rat): 365564Help
Entry
365564            CDS       T01003                                 

Gene name
Atoh7
Definition
(RefSeq) atonal bHLH transcription factor 7
  KO
K09083  atonal protein 1/7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    365564 (Atoh7)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    365564 (Atoh7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH DUF1295
Motif
Other DBs
NCBI-GeneID: 365564
NCBI-ProteinID: NP_001163953
RGD: 1304957
Ensembl: ENSRNOG00000000384
UniProt: D3ZG53
Position
20p11
AA seq 149 aa AA seqDB search
MKSACKPHGPPAGARGAPPCAGAAERAVSCAGPGRLESAARRRLAANARERRRMQGLNTA
FDRLRRVVPQWGQDKKLSKYETLQMALSYIVALTRILAEAERDWVGLRCEQRGRNHPYLP
FPGARLQVDPEPYGQKFFGFQPESFPMAS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgcctgcaaaccccacggtcctccggcgggagcacgcggcgcgcccccgtgc
gcgggcgcagccgagcgcgcggtctcctgcgcggggcccgggcggctggaaagcgcagcg
cgcaggcgcctggcggccaacgcgcgcgagcggcgccgcatgcaagggctgaacaccgcg
ttcgaccggctgcgcagggtggtgccgcaatggggccaggacaagaagctgtccaagtac
gagacactgcagatggcgctcagctacatcgtggcgctcacccgcatcctagccgaagcc
gagcgggactgggtggggctgcgctgcgagcagcggggccgcaatcacccctacctccca
ttccccggtgctaggctccaggtagaccctgagccctacgggcagaagttcttcggtttc
cagccagagtccttccccatggccagctaa

DBGET integrated database retrieval system