KEGG   Rattus norvegicus (rat): 365571Help
Entry
365571            CDS       T01003                                 

Gene name
Tysnd1
Definition
(RefSeq) trypsin domain containing 1
  KO
K23012  peroxisomal leader peptide-processing protease [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     365571 (Tysnd1)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   365571 (Tysnd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin
Motif
Other DBs
NCBI-GeneID: 365571
NCBI-ProteinID: NP_001102402
RGD: 1307354
Ensembl: ENSRNOG00000024839
UniProt: B1H261
Position
20q11
AA seq 567 aa AA seqDB search
MGRQWGPSLRVAEQAGCVVSASRAGQPDAGSWSCSGVILSRSPGLVLCHGGIFTPFLRTG
SAALTQTGAAFLPGDSCSDDLRLHVQWGPTAASPAGRADQELPGLCTPQCASLGLEPGAP
SRARARPLQPPRPAQLLLLLSCPAFRSHFARLFGAEAADQWHFVSSAPDDAVSEEEEEDQ
LRALGWFALLRVQRGAAAEERRGPAVTVAPLGAVAKGAPLLACGSPFGAFCPDIFLNTLS
RGVLSNAAGPLLLTDARCLPGTEGGGVFAARPAGALVALVAAPLCWKAREWVGLTLLCAA
APLLQVARSALSRLHPDSTSLSALLPPEVGAPRGLSLRDLGSSWAAAAVLVECGAVWGSG
VAVAPRLVVTCRHVAPRETARVLVHSATPRNVAIWGRVVFATQETSPYDIAVVSLEEELN
GVPVPVPAEHFHEGEPVSVVGFGVFGQACGPSVTSGILSAVVHVDDAPVMLQTTCAVHGG
SSGGPLFSTRSGDLLGIVASNTRDNNTGATYPHLNFSIPITVLQPALKQYSQTGDLCGLR
ELDHTTEPVRVVWRLQRPLPEAPRSKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggacggcaatggggaccgtctttgagagtggcagagcaggcgggttgcgtagtgagc
gcctcgcgagcaggacagcccgatgcgggctcgtggagctgcagcggggtgatcctgagc
cgcagcccaggcctggtgctgtgccacgggggcattttcacccccttcctcagaactggt
agcgcggctttgacccaaacgggagccgccttcctaccgggcgacagttgcagcgatgac
ctgcgcctccacgtgcagtggggacccacggctgccagccccgccggccgcgcggaccag
gaacttccagggctgtgcacgcctcagtgcgcaagcctgggcctcgaacccggtgccccg
agccgggcccgcgcgcggcctctgcagcctccgcggccggcgcagctgctgttgctgctc
agctgcccggccttccgctcgcacttcgcgcggctcttcggggccgaagcggcggatcaa
tggcacttcgtgagctcggcgcccgacgacgcggtgtcagaggaggaggaggaggatcag
ctgcgcgcgctcggctggttcgccctcctgcgggtgcagcggggcgcggcggccgaggag
aggcgcgggccggcggtgaccgtggcaccgctcggggccgtggccaagggcgcaccgctg
ctggcttgtggctctccgttcggtgccttctgcccggacatcttcctcaacacgctgagc
cggggcgtgctcagcaacgcggccggtccgctgttgctcaccgacgcgcgctgcctgccg
ggcacagaaggcggcggagtgttcgcggcccgacctgcgggcgcgctggtggctctggtg
gccgcgcctctatgctggaaggcccgcgagtgggtgggcctcacgttgctgtgcgccgct
gcccctctgcttcaggttgctcgctcggctctctctcgcctgcatccggactccacctct
ctgtccgcgctgctgccacccgaagtgggcgcgccaaggggcctgtccctacgagatctc
ggatcctcgtgggcagccgcggcggtgctggtggagtgtggtgccgtgtggggctccgga
gtggctgtggcgcctcgcctggtggtgacctgccgtcatgtggcaccccgggaaacagcc
agggtcttggtacactcagctacacccaggaatgtggcaatctggggacgagtggtattt
gccactcaggagacctctccatatgacatagcggtggtgagcctggaagaggaactgaat
ggtgtccccgtgcctgtcccagctgagcacttccatgaaggcgagcctgtcagcgtggtg
ggctttggcgtgtttggccaggcctgcgggccctcagtgacctcaggcatcctgtcggcc
gtggtgcatgtggatgatgccccagtgatgctacagaccacctgtgccgtgcatggcggc
tctagcggaggacctctcttctctacacgctcgggggacctcttgggcattgttgctagc
aacactcgggacaacaacacgggggccacctacccacacctgaacttcagcatccccatc
accgtgctccagccggccctgaagcagtacagtcagactggtgacctgtgtggcctcaga
gagctggaccacaccactgagcctgtcagggtcgtgtggcggctgcagcggcccctgccg
gaagccccccggagcaagctctga

DBGET integrated database retrieval system