KEGG   Rattus norvegicus (rat): 365581Help
Entry
365581            CDS       T01003                                 

Gene name
Edar, RGD1561714
Definition
(RefSeq) ectodysplasin-A receptor
  KO
K05162  tumor necrosis factor receptor superfamily member EDAR
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    365581 (Edar)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    365581 (Edar)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   365581 (Edar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 OAD_gamma
Motif
Other DBs
NCBI-GeneID: 365581
NCBI-ProteinID: NP_001178828
RGD: 1561714
Ensembl: ENSRNOG00000028598
UniProt: D3ZGP2
Position
20q11
AA seq 448 aa AA seqDB search
MAHVGDCKWMSWLPVLVVSLMCSAKAEDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSC
GYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGY
YMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSS
QGHLATALIIAMSTIFIMAIAIVLIIMFYIMKTKPSAPACCSSPPGKSAEAPANTHEEKK
EAPDSVVTFPENGEFQKLTATPTKTPKSENDASSENEQLLSRSVDSDEEPAPDKQGSPEL
CLLSLVHLAREKSVASNKSAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRML
SSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIER
LDAVESLCADILEWAGVVPPASPPPAAS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtcggggactgcaagtggatgtcctggctcccagtgctggtggtgtctctg
atgtgctcagccaaggcagaggactccaactgtggcgagaatgaataccacaaccaaact
accgggctgtgccagcagtgtcctccatgcagaccaggggaggagccctacatgtcctgt
ggttacggcaccaaagatgaggactatggctgcgtgccctgccctgcagagaagttctcc
aaaggaggttatcagatatgcaggcgccacaaggactgtgagggcttcttccgggccacc
gtactgacaccaggagacatggaaaatgatgctgagtgtggcccgtgtctgcctggctac
tacatgctggaaaacagacccaggaacatctacggcatggtctgctactcctgcctcttg
gcacctcccaacaccaaggaatgtgtgggagccacttccggggtttcagctcactcctcc
agcacttcaggcggcagcaccttgtcccccttccagcatgctcacaaagagctctcaagt
caaggacacctggccaccgccctgattattgccatgtctacaatcttcatcatggccata
gccattgtcctcatcatcatgttctatatcatgaagactaagccttcagctccagcctgc
tgtagcagtcccccaggaaaaagtgcagaagccccagctaacacacatgaggagaaaaaa
gaggccccagacagtgtggtgactttccctgagaatggtgaattccagaagttgacagca
acacccacaaagaccccaaaaagtgagaacgatgcctcctctgagaatgagcagctgctg
agtcgcagtgtggacagtgatgaagagccagccccggacaagcaggggtccccagagcta
tgcctgctgtcgctagttcatctggccagggagaagtctgtagccagtaacaagtctgct
gggatccaaagccgaaggaaaaagatattggatgtgtatgcgaacgtgtgtggtgttgtt
gaaggtctcagccccacggagctgccttttgattgccttgaaaagacaagcagaatgctc
agttctacctacaactctgagaaagcagtcgtgaaaacgtggcgccaccttgctgagagc
tttggactgaagagggatgagattgggggcatgactgatggcatgcagctctttgaccgc
atcagcactgcgggctacagcatcccagagctgctcacgaagctggtacagatcgagagg
ctggatgctgtggagtccttgtgtgcagacatattggagtgggctggggttgtaccccct
gcctccccacccccagctgcatcctga

DBGET integrated database retrieval system