KEGG   Rattus norvegicus (rat): 365652Help
Entry
365652            CDS       T01003                                 

Gene name
Col4a3bp
Definition
(RefSeq) collagen type IV alpha 3 binding protein
  KO
K08283  collagen type IV alpha-3-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    365652 (Col4a3bp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: START PH PH_8 PH_11 Acyl_CoA_thio
Motif
Other DBs
NCBI-GeneID: 365652
NCBI-ProteinID: NP_001102405
RGD: 1309131
Ensembl: ENSRNOG00000015686
UniProt: D4ACN6
Position
2q12
AA seq 624 aa AA seqDB search
MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDE
TEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWVDAIEQHKTESG
YGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQK
YFDVCADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHVTPKGINGID
FKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDREVEKRRRVEEAYKNVTEELKK
KPRFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPPSLPSGDTFS
SVGTHRFVQKPYSRSPSMSSIDLVSASDDVHRFSSQVEEMVQNHMNYSLQDVGGDANWQL
VVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHV
VETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFSVDHDSAPL
NNRCVRAKINIALICQTLVSPPEGDQEISRDNILCKITYVANVNPGGWAPASVLRAVAKR
EYPKFLKRFTSYVQEKTAGKPILF
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataaccagagctggaactcgtcgggctcggaggaggatccggagacagagtcc
gggccgcctgtggagcgctgcggagtcctcagcaagtggacaaactatattcatgggtgg
caggatcgttgggttgttttgaaaaataatactttgagttactacaaatctgaagatgaa
acagaatatggctgtaggggatccatctgtctaagcaaggctgtgatcacgcctcatgac
tttgatgaatgccggtttgatattagtgtgaatgatagtgtttggtatcttcgtgctcag
gacccagatcatagacagcagtgggtagacgccattgagcagcacaagactgaatcagga
tatggatctgagtccagcttgcgtagacatggctcaatggtgtcactggtgtctggagca
agtggctattctgctacgtccacatcttcattcaagaaaggccacagtttacgtgagaag
ttggctgaaatggaaacctttagagacatcctgtgtaggcaggttgatactctgcagaag
tactttgatgtctgtgctgatgctgtctccaaggatgaacttcaaagggataaagtggta
gaagacgatgaagatgacttccctacaactcgctctgatggagacttcttgcacaatacc
aatggtaataaggaaaaattatttccacatgtaacaccaaaaggaattaatggcatagac
tttaagggggaagcaataacttttaaagcaactactgctggcatccttgctacactgtct
cattgtattgaactgatggtaaaacgcgaagaaagctggcaaaaaaggcatgatagggaa
gtggaaaagcggagacgagtagaggaagcatacaagaatgtgacggaggaacttaagaag
aaacctcgcttcggagggccagactatgaagaaggtccaaacagtctgattaatgaggaa
gagttctttgatgctgttgaagctgctcttgacagacaagataaaatagaggaacagtca
cagagtgaaaaggtcaggttacactggcctccgtcattgccatctggagataccttttct
tcagttgggactcacagattcgtacaaaagccctatagtcgctctccctccatgtcttcc
attgatctagtcagtgcctctgacgatgtccacagattcagctcccaggttgaagagatg
gtacagaaccacatgaattattcattacaggatgtaggtggtgatgcaaattggcagctg
gttgtagaagaaggagaaatgaaggtgtacagaagagaagttgaagaaaatggaatcgtt
ctggatcctttgaaagctactcatgcagttaaaggtgttacaggacacgaggtctgcaat
tacttttggaatgttgatgttcgcaatgactgggaaactactatagaaaactttcatgtg
gtggaaacattagctgataatgcaatcatcatttatcaaacgcacaagagagtgtggccc
gcttctcagagagacgtgctgtatctttctgctattcggaagatcccagccttgactgag
aacgaccctgagacttggatagtttgtaatttctctgtggaccatgacagtgctcctctg
aacaatcgatgtgtccgtgccaaaatcaatattgctttgatttgtcaaactttggtaagc
ccaccagagggagaccaggagataagcagagacaacattctgtgcaagattacatatgta
gctaatgtgaacccaggaggatgggcgccagcctcggtgttaagagcagtggcaaagcga
gaataccctaagtttctaaaacgatttacttcttatgtccaagaaaaaactgcaggaaaa
ccaattttgttttag

DBGET integrated database retrieval system