KEGG   Rattus norvegicus (rat): 365699
Entry
365699            CDS       T01003                                 

Gene name
Nadk2, Nadkd1, RGD1306809
Definition
(RefSeq) NAD kinase 2, mitochondrial
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    365699 (Nadk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     365699 (Nadk2)
SSDB
Motif
Pfam: NAD_kinase DAGK_cat TPALS
Other DBs
NCBI-GeneID: 365699
NCBI-ProteinID: NP_001037717
RGD: 1306809
Ensembl: ENSRNOG00000054157
Vega: OTTRNOG00000001736
UniProt: Q1HCL7
Position
2q16
AA seq 425 aa
MDTSAIQQTLVKIYQRQAWQPPRKASKNETTVGKPRELAGGGSPADGGFRPSRVVVVAKT
TRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRDEGIEVR
LVKRREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVR
YTHSFPEALQKFSRGEFRWLWRQRIRLYLEGTGINPSPVDLHEQQLSLNQHSRAFNIERV
DDERSEASGPQLLPVRALNEVFIGESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSK
AWSFNINRVAAQAVEDVLNIARRQGNLTLPLNKELVEKVTNEYNESLLYSPEEPKILFSI
REPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRT
VILEQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggacacatcagctatccagcagacactggttaaaatttaccaaagacaagcatggcaa
ccacccagaaaagctagcaaaaatgaaacaactgtggggaagccgcgcgagctggcgggc
ggtggtagccccgccgacggcggcttccgcccctcgcgggtggttgtggtggcgaaaacc
acccgctatgagttcgagcagcagcggtaccgctatgcggagctctccgaggaggacctg
aagcagctgcttgcattgaaaggctcgagctacagtgggctacttgagcgacatcatatc
cacaccaaaaatgtcgaacacatcattgatagcttacgggatgaagggatcgaggtgcgc
ctggtaaagcggagagagtacgacgaagagactgttcgatgggcagatgctgtcatagcc
gcaggaggtgatggcacgatgcttctggccgccagtaaagttctggacagacttaaacct
gtcattggggtcaacactgatccggaacggtctgaaggtcacttatgtctgcctgtgcga
tacacacattccttccccgaagccttacagaagttctctcgtggtgagttcaggtggtta
tggaggcagcggatcaggttatatctggaagggaccggcatcaaccccagtcccgtggac
ctccacgaacagcagctgagcttgaatcagcacagccgagcctttaacatcgaaagagtg
gacgatgaaagatccgaggcttcaggacctcagcttctgccggtgagagcgctcaatgaa
gtcttcattggggagagcctgtcatccagggcttcttactatgaaatttcagttgatgat
ggcccatgggagaagcagaagagttcagggctcaatttgtgtactggaacaggatcgaag
gcctggtcattcaatatcaacagggttgcagctcaggctgttgaagatgttttaaatatc
gccagacgacaaggaaatctgactcttccactgaacaaagaattggtagaaaaagtaaca
aacgaatataacgagtcactgctctacagtccagaagaacccaaaatactcttcagtatc
cgagagccaatagcaaacagagttttctcaagcagccgtcagcgttgtttctcctcaaaa
gtttgtgttcgttctcggtgttgggatgcctgcatggttgtggatggaggaacatctttt
gagtttaacgacggagcaattgcttcaatgatgatcaataaagaagatgagcttcgaact
gtgattctagaacagtga

DBGET integrated database retrieval system