KEGG   Rattus norvegicus (rat): 365755
Entry
365755            CDS       T01003                                 

Gene name
Tbl1xr1, RGD1560053
Definition
(RefSeq) transducin (beta)-like 1 X-linked receptor 1
  KO
K04508  transducin (beta)-like 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    365755 (Tbl1xr1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A LisH Coatomer_WDAD WD40_like Nup160 PD40 PCuAC
Other DBs
NCBI-GeneID: 365755
NCBI-ProteinID: NP_001102411
RGD: 1560053
Ensembl: ENSRNOG00000011216
UniProt: D3ZNF4
Position
2q24
AA seq 514 aa
MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYV
EAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQHAAAAAAAAAATNQ
QGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWNPV
SDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLL
ATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEA
KQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPT
GNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASF
DSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSY
RGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgagtataagcagtgatgaggtcaacttcttggtatataggtacttgcaagagtcagga
ttttctcattctgcatttacctttggtatagagagccatataagtcagtccaacataaat
ggtgccctcgtcccacccgctgcactcatctctatcatccagaaaggcctgcaatatgta
gaggcagaagttagcataaatgaggatggcaccttatttgatggtcgacccatagagtct
ctgtccctgatagatgctgtcatgcccgatgtcgtccaaacaagacaacaagcctacaga
gacaagcttgcacagcaacatgcagccgctgctgcagctgctgccgcagccactaaccag
caaggctctgcgaaaaatggagagaacacagccaatggggaggagaatggagcacacacc
atcgcaaataatcacacggacatgatggaggtggacggggatgtggaaatccctcccaat
aaagcggttgtgcttcggggccatgaatcggaagttttcatctgtgcctggaaccctgtt
agtgatctcctggcatcagggtctggagactccactgcaagaatatggaacctcagtgag
aacagcacaagtggccccacacagctggtgcttagacactgcatacgggaaggagggcag
gacgttcccagtaacaaggatgtcacctctctagattggaatagtgaaggtacacttcta
gcaactgggtcatatgacggatttgccagaatatggactaaagatggtaatcttgccagc
accttggggcagcataaaggtcctatatttgcattaaaatggaataagaaaggaaatttc
atcctaagtgctggtgtagacaagaccaccatcatttgggatgcgcatactggagaagcc
aagcagcagtttcctttccattcagccccagcactggatgttgactggcagagcaacaac
acctttgcatcttgtagtacagatatgtgcattcacgtctgcaaattaggacaagacaga
cctatcaaaacattccagggacacacgaatgaagtaaatgctatcaaatgggacccaact
ggcaatctcctagcctcctgttcagatgacatgacattgaagatatggagtatgaagcaa
gataactgtgttcatgatttacaagcacataataaagaaatttatactattaaatggagt
ccaacaggaccagggacaaataatccgaatgccaaccttatgctagcaagtgcatccttt
gattctacagttaggttatgggatgtagaccgagggatttgcatccatactttgacaaaa
catcaagagcctgtgtacagtgtggcttttagtcctgatggcaggtatctggcaagtggt
tcttttgacaagtgtgtgcacatctggaacacacagacaggtgctctagttcacagttac
aggggaacaggtgggatttttgaagtttgctggaacgcagcaggagacaaagttggagcc
agtgcttcggatggttcagtttgtgtcttagatcttcggaaatag

DBGET integrated database retrieval system