KEGG   Rattus norvegicus (rat): 365797Help
Entry
365797            CDS       T01003                                 

Gene name
Ufm1, RGD1304890
Definition
(RefSeq) ubiquitin-fold modifier 1
  KO
K12162  ubiquitin-fold modifier 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    365797 (Ufm1)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   365797 (Ufm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ufm1
Motif
Other DBs
NCBI-GeneID: 365797
NCBI-ProteinID: NP_001119552
RGD: 1304890
Ensembl: ENSRNOG00000038176
UniProt: Q5BJP3
Position
2q26
AA seq 85 aa AA seqDB search
MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPA
QTAGNVFLKHGSELRLIPRDRVGSC
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggtgtcctttaaaatcacgctgacgtcggacccgcggctaccgtacaaagtc
ctcagcgttcctgaaagcacacctttcacagctgtgctaaagtttgcagcagaagagttt
aaagttcctgctgctacaagtgcgattattactaatgatggaataggaattaatcctgca
cagactgctggaaacgtttttctgaagcacggctcagagctgcggctcattcctcgagac
cgagttgggagctgctaa

DBGET integrated database retrieval system