KEGG   Rattus norvegicus (rat): 365823Help
Entry
365823            CDS       T01003                                 

Gene name
Fstl5
Definition
(RefSeq) follistatin-like 5
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig Kazal_2 V-set Kazal_1 EF-hand_1 EF-hand_6 EF-hand_7 Ig_6 C1-set EF-hand_5 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 365823
NCBI-ProteinID: NP_001258124
RGD: 1306858
Ensembl: ENSRNOG00000047002
Vega: OTTRNOG00000000726
UniProt: A0A096MK67
Position
2q32
AA seq 847 aa AA seqDB search
MFKCWSAVLILGFIFLASEGRPTKESGYGLKYYQPLTRLRHKQEKSQESSRIKEFLIHDG
PFGSCENKYCGLGRHCVISRETRHAECTCMDLCKQHYKPVCGSDGEFYENHCEVHRAACL
KKQKITIVHNEDCFFKGDNCMTTEYSKMKSMLLDLQNQKYITQENENPNSDDISRKKTLV
DQMFKYFDADSNGLVDINELTQVIKQEELNKDLSDCTLYDLLKYDDFNADKHLALEEFYR
AFQVIQLSLPEDQRVSITAATVGQSAVLSCAVVGTLRPPIIWKRNNIVLNNLDLEDINDF
GDDGSLYITKVTTVHMGNYTCYADGYEDVHQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIARNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYDDGVKVIQPTECEFQRHIKPSE
KLLGFQDEVCPKDEEDEVQRCVWASAVNVKDKFIYVAQPTLDRILIVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDD
FFIPTPTLIITHMRFGFILHKDESALHKIDLETMSYIKTISLKDSKCIPLSLAYSHLGGY
YFISCKPDITGAIPPQLVVDSVTDSIIGSNSDVTGTPYVSPDGHYLVSVNDVKGLVRVQY
ITIRGEILDAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSQQTDVLFVELSTGKVKMIK
SLKEPLKTEDWPWSPKNRHIQGSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVQKGNT
VVWVGDA
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtgctggtcagccgttttgattcttggattcatcttcctggcttctgaaggg
aggccaacaaaagaatcaggatatggccttaaatactatcaacctctcacaagattacga
cataagcaggaaaaaagtcaagaaagttcaagaatcaaagaatttctaattcacgatgga
ccttttggatcttgtgaaaataagtactgtggcttggggaggcactgtgttatcagcaga
gagacaaggcacgctgagtgtacgtgcatggacctctgcaaacagcactacaaacctgtg
tgtggatctgatggggaattctatgagaaccactgtgaagtgcacagagctgcctgcctg
aaaaagcaaaagatcaccattgttcacaacgaagactgcttctttaaaggagacaactgc
atgacaactgaatacagcaaaatgaaaagtatgcttttagacttacaaaatcaaaagtac
attacacaagaaaatgagaatcccaacagcgatgacatttctaggaagaagacgttggtg
gatcaaatgttcaagtattttgatgcagacagtaatggacttgtagatattaatgaacta
actcaggtgattaaacaggaggaactgaacaaagacctgtctgactgtacgttgtatgat
ctgctcaagtatgatgatttcaatgctgacaagcacctggctcttgaagaattctacaga
gcatttcaggtgatccagttgagtctgcccgaagatcagagagtaagcattaccgcagcc
accgtgggacagagtgctgttctgagctgtgccgttgtgggaacactgagaccccctatc
atatggaagaggaacaacattgttctaaataatttagatttggaagacatcaatgacttt
ggcgatgatgggtccttatatatcaccaaggttaccacagttcatatgggaaattatacc
tgctatgcagatggctatgaagatgtccatcagacacacatcttccaagtgaatgtccct
ccagtcatccgagtgtatccagagagtcaggccagagaacctggggtaactgcaagcctg
aggtgccatgcagagggcataccggaccctcagcttgggtggttgaagaatggaatcgat
attacaccaaagctctccaaacagctcacgcttcaagcaaatggcagtgaggtccacata
agcaatgtgcgttatgaagatacaggagcatacacgtgcattgctaggaatgaagccggt
gtggatgaagacatctcttctctttttgtggaagattctgctagaaagacactagctaac
atattatggagagaagaaggtctgggaattgggaacatgttctatgtgttttatgacgac
ggagtcaaagtgatacaacccacggaatgtgaatttcagaggcacattaagcccagtgaa
aagctccttggatttcaggatgaagtctgtcccaaagatgaagaggatgaagtgcagaga
tgtgtttgggcttcggctgttaatgtcaaagacaagttcatttatgttgctcagccaact
ttggatagaatcttgattgttgatgtgcagtcccaaaaagttgttcaggcagtgagtaca
gaccctgtaccagttaaattacactacgacaagtcacatgaccaggtctgggtgctgagc
tggggcagcatggagaagacatcgccaactttacaggtgatcactctggccagcgggaat
gtgcctcaccacaccatccacacacagcctgtcgggaaacagtttgacagagtggatgac
tttttcattcccaccccaacacttattattactcacatgagatttggatttattcttcat
aaagatgaatctgcactacacaaaattgatctcgaaaccatgtcctacatcaaaacaatt
agcctgaaggactcaaagtgcattcctctgtccttggcatacagccatctgggaggatac
tacttcattagctgcaagcctgacatcactggagccattccaccacagcttgtggtggac
agtgtgactgattctatcattggctccaacagtgatgtgacaggcactccttacgtctct
ccagacggacactatcttgtcagtgttaatgatgtgaaaggtcttgtcagagtccaatat
atcaccatccgaggagaaatcctggatgcctttgacatccacaccaacctgcacatatct
gacctggccttccagccatccttcacagaagcccaccagtacaacatctacggcagttca
agccaacaaacagatgtgctctttgtggagctgtccactgggaaggtcaagatgatcaaa
agtctcaaagaacctctcaagacagaagactggccctggagtccgaaaaacaggcacatc
caaggcagtggcctgtttggacagtacctgatgaccccctccaaagattctctcttcatc
ctggatggtcgccttaataagttaaactgtgagatcactgaggttcagaaaggaaataca
gttgtttgggttggcgatgcctaa

DBGET integrated database retrieval system