KEGG   Rattus norvegicus (rat): 365841
Entry
365841            CDS       T01003                                 

Gene name
Slc25a44, RGD1307244
Definition
(RefSeq) solute carrier family 25, member 44
  KO
K15121  solute carrier family 25, member 44
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    365841 (Slc25a44)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   365841 (Slc25a44)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 365841
NCBI-ProteinID: NP_001102417
RGD: 1307244
Ensembl: ENSRNOG00000025269
Vega: OTTRNOG00000002063
UniProt: D3ZSN7
Position
2q34
AA seq 337 aa
MARGMPEDPELAVQEPDRRSPGNMEGKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYP
FTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVTGLYRGFLVNTFTLISGQCYVTTYELT
RKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQRKGEKMGRFQVRGNLEG
QGLIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSRLCPQ
ECPHIVFQAISGPLAAATASVLTNPMDVIRTRVQVEGKSSIILTFRQLMAEEGPWGLMKG
LSARIISATPSTIVIVVGYESLKKLSLRPELVDSRHW
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgaggggcatgcccgaggaccctgaattggcagtgcaagagccagacagaaggtct
ccgggcaacatggagggcaagcggaacattcagatcatcgagtgggagcacctggacaag
aagaagttctacgtgttcggtgtggctatgacaatgatgatcagggtcagcgtgtacccg
ttcaccctcatccgcacccgcctgcaggtccagaagggcaagagcctctaccatgggacc
tttgatgcctttgtcaaaatccttcgagcagatggagtgactggcctctaccggggattc
ctggtgaacaccttcacactcatctctggccagtgctatgttaccacttacgagcttacc
cggaaatttgtagctgactacagccagagtaacacagtcaaatcactggtagccggtggc
tcagcctccctcgtggcccagagcatcacggtgcccattgatgttgtctcccagcatctg
atgatgcagcgcaagggtgagaaaatgggtcggttccaagtgcgtgggaacctagaggga
caagggctgattgcctttggccaaactaaagacatcatcaggcagatcctgcgggctgat
gggcttcgaggcttctaccggggctatgtggcctcactgctaacgtatatcccaaacagc
gcggtttggtggcccttttaccacttctatgcagagcagctgtcgcgcctgtgccctcag
gagtgccctcacattgtctttcaagccatctctgggcccctggctgcagccactgcctcc
gtcctcaccaatcccatggatgtcatcagaacccgtgtgcaggttgaaggcaagagctcc
atcatcctgaccttcagacagctgatggcggaagaggggccttggggcctcatgaagggc
ctctcagcccgaatcatctcggctacaccctccaccatcgtcatcgtggtgggctacgag
agcctcaagaaactcagcctgcgacccgagctggtggactcaagacactggtag

DBGET integrated database retrieval system