KEGG   Rattus norvegicus (rat): 365885Help
Entry
365885            CDS       T01003                                 

Gene name
Olr390
Definition
(RefSeq) olfactory receptor 390
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    365885 (Olr390)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    365885 (Olr390)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    365885 (Olr390)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx Spt20
Motif
Other DBs
NCBI-GeneID: 365885
NCBI-ProteinID: NP_001000558
RGD: 1334203
Ensembl: ENSRNOG00000017664
UniProt: D3ZSW0
Position
2q34
AA seq 320 aa AA seqDB search
MTPFEVTNQTRVTEFIFLGFSNHSSLRGFFFLVFLAIYLTTLLGNTLMMVATRVSPALNT
PMYYFLSNLSFLDICYTSTTIPAMLVNFFREKKTISYEGCLSQIFFFVTCAGTECVLLAA
MAYDRYVAICYPLRYPVLMSTRVCICLVIGSWLCGLVNSVTHTTLATTLTLCGPNQISHF
LCDIPLLLKLSCSDTSVNESVLHVASATIGLSPCLFTAGSYIFIISAILRIPSAQGRRKA
FSTCASHLTVVVIFFGTANFNYDRPREGYSLDMDILVSVLFCVVTPMLNPIIYSLRNKEV
KGALGKLIGAHSLTVTTPRE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgactccatttgaagtgaccaatcaaacacgtgtcacagaattcatcttcctgggattc
tccaaccactccagcctacggggcttcttcttcctggtcttcctggccatttacctgaca
actctcctggggaacacactcatgatggtggccaccagggtcagccctgctctgaacact
cccatgtactatttcctcagcaacttgagcttcctggacatctgctacacgtccaccacc
attccggccatgctagtgaacttcttccgggagaagaagaccatctcctatgagggctgc
ctctcccagatcttcttctttgtgacatgtgctggaactgaatgtgttttgttggccgcc
atggcttatgaccgctatgtggccatttgctaccctcttcggtatccagttctcatgagc
acaagggtctgtatctgcttggtgattgggtcctggctctgtggcttagtgaattctgtg
actcacacaacattggcaaccacactcactctgtgtggccccaaccagatcagccacttt
ctctgtgacatcccactgctcctgaagctctcctgctcagacacctctgtcaacgaatct
gtcctccatgtggccagtgccaccattggcctgagcccctgcctgttcactgcaggctcc
tacattttcatcatctctgccatcctgaggattccctctgctcagggcaggagaaaggcc
ttctccacctgtgcctcgcacctcactgtggtggtgatcttctttggaacagccaacttc
aactatgacagacccagggaaggctactccctggacatggacatattggtgtctgtgctc
ttctgtgttgtgacccccatgttgaaccctatcatctacagcctgagaaacaaggaggtc
aaaggtgctctgggaaagctgattggagcgcattccctaacagtaacaacgcctagagag
taa

DBGET integrated database retrieval system