KEGG   Rattus norvegicus (rat): 365924Help
Entry
365924            CDS       T01003                                 

Gene name
Tmem56, RGD1563041
Definition
(RefSeq) transmembrane protein 56
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Ferric_reduct
Motif
Other DBs
NCBI-GeneID: 365924
NCBI-ProteinID: NP_001129351
RGD: 1563041
Ensembl: ENSRNOG00000025160
UniProt: D4AAE5
Position
2q41
AA seq 263 aa AA seqDB search
MEANTNVVIGTVCCSFVTFQLLFHFISCWFSARVSLGYNSLSTEKKIEWNSRVVSTCHSM
LVGIFGLYLFFFDEATIADPLWGDPSLVKINISTASGYLISDLLIILFNWKVIGDKFFII
HHCAGLIAYYFVLKIGVLAYIANFRLLAELSSPFVNQRWFFEVLKYPKFSKVNVINGILM
TVVFFIVRIIAIPPMYFYVYSVYGTEPYIRLGSVVHFVWISSCIVLDVMNIMWMIKITKG
CMKVISLIRQEKAKDSLQNGKLD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaacactaacgtggtcatcggcaccgtctgctgcagctttgtcacttttcag
cttcttttccatttcataagttgctggttttcagcaagagtctctctgggctataacagt
ctcagcaccgagaagaagatcgaatggaactcgagggtagtgtccacgtgccactctatg
ctggttgggatttttggtttatacctcttcttcttcgatgaagctactatagctgatcca
ctctggggtgatccatcacttgtgaaaataaatatttcgactgcttcaggctacctcatt
tctgatttattgattatactttttaattggaaagtgatcggagacaaattttttataatt
caccattgcgcaggactaattgcatactactttgtattgaaaattggagtgcttgcatac
attgccaatttccgcctgcttgctgagctttccagcccctttgtaaaccagagatggttc
tttgaagtcctgaagtaccccaagttttccaaagtcaatgtcatcaatggaattcttatg
accgtggtctttttcatcgtgcggatcatcgcgatacctccaatgtacttctacgtttac
tccgtgtacggaacagaaccctacataaggcttggatctgtagtccattttgtctggatc
tcttcttgtattgttttagatgtgatgaacatcatgtggatgatcaaaatcacaaaagga
tgcatgaaagtcatctctctcatcagacaagagaaagccaaggacagccttcagaatgga
aaactcgattaa

DBGET integrated database retrieval system