KEGG   Rattus norvegicus (rat): 366013Help
Entry
366013            CDS       T01003                                 

Gene name
Coq4
Definition
(RefSeq) coenzyme Q4
  KO
K18586  ubiquinone biosynthesis protein COQ4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    366013 (Coq4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Coq4
Motif
Other DBs
NCBI-GeneID: 366013
NCBI-ProteinID: NP_001026832
RGD: 1304638
Ensembl: ENSRNOG00000026691
UniProt: Q4FZU1
Position
3p12
AA seq 265 aa AA seqDB search
MATLLLRSQRLHRSLRHRTRPTVDVLLRAASHGARLLYPDHIPTTPLQKMLLAAGAAGMA
LYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQILQERPRISLSTLDLSKLQSLPE
GSLGREYLRFLNANKVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNMLGEV
VVKWFEAVQTGLPMCILGALFGPVRLRAQSLQVLFSELIPWAIQNGRRAPCVLNIYYEQR
WEQPLTALREELGISPPPKHIQGLA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctgctgcttcgctcccagcgcctccaccgcagtctccggcaccgtacgcgg
ccaactgtagatgtgctcctcagggccgcgagccatggcgcccgcctgctgtacccagac
cacatccctactacgccgctgcagaagatgctgctggccgccggcgcggcgggaatggcg
ctctacaatccctatcgccacgacatggttgcagttctaggggagaccacaggatgccac
accctgaaattcctcagggaccagatgaagaaggatccagagggtgcccagattctgcaa
gagcgtccccgaatctcactgtctaccctcgatctaagtaagctccagagcctgcctgaa
ggctctctgggccgtgagtatctgcgcttcctgaatgcgaataaagtctctccagataca
cgagcacctacacgctttgtggacgatgaagaactagcctatgtgatccagagataccgt
gaggtgcatgatatgctccacaccctgctggggatgcccaccaacatgctcggagaagtt
gtggtaaagtggtttgaggctgtgcagactggccttcccatgtgcatcctgggagcactc
ttcggacccgtccgtctccgtgctcagagcctccaggtgcttttctcagagctgatccct
tgggcgattcagaacgggcgcagggccccatgtgtcctcaacatctactatgaacagcgt
tgggagcagcccctgacagccctacgggaggagctgggcatcagtcctcccccaaaacac
atccagggcctggcctag

DBGET integrated database retrieval system