KEGG   Rattus norvegicus (rat): 366064
Entry
366064            CDS       T01003                                 

Gene name
B3galt1
Definition
(RefSeq) Beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Module
rno_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    366064 (B3galt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    366064 (B3galt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     366064 (B3galt1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 1 chain
   366064 (B3galt1)
SSDB
Motif
Pfam: Galactosyl_T
Other DBs
NCBI-GeneID: 366064
NCBI-ProteinID: NP_001102424
RGD: 1311898
Ensembl: ENSRNOG00000007625
UniProt: D3ZPD8
Position
3q21
AA seq 326 aa
MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINP
HSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQISPEEMHRIWNDMSSKKHLRC
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcgtcaaaggtttcctgcctgtatgtgttgaccgttgtgtgctgggccagcgctctc
tggtacttaagcataacaagacctacttcatcatacactggctcaaagccattcagtcac
ctaacagttgccaggaaaaacttcacgtttggcaacataagaactcgacctataaaccca
cattcttttgagtttcttataaatgaacccaacaaatgtgagaaaaacattccttttctt
gtgatcctcattagcaccacccacaaggaatttgatgcccgccaggcaatccgggagact
tggggggatgagaacaacttcaaagggatcaagatagccacgcttttcctcctgggcaaa
aatgctgatcctgttctcaaccagatggtggagcaagagagccagatcttccatgacatc
atcgtggaggacttcattgactcctaccacaacctcaccctcaaaaccttaatggggatg
agatgggttgccaccttctgctcaaaagccaagtatgtcatgaaaacagacagtgacatt
tttgtgaacatggacaaccttatttataaactcctgaaaccctctaccaagccgagaaga
agatatttcactggttacgtcatcaatggcgggccaatcagggatgtccgcagtaagtgg
tatatgcctagggatttgtaccctgacagcaactacccaccgttctgttcggggactggc
tatatcttttccgctgatgtggcagaactcatttacaagacctcactccacaccaggctg
cttcatcttgaagatgtgtatgtgggactgtgtcttcgaaagctgggcatacatcctttc
cagaatagtggcttcaatcactggaaaatggcctacagtttgtgtaggtaccgccgcgtc
atcaccgtccatcagatctctccagaggaaatgcacaggatctggaatgacatgtcaagc
aagaagcatctcagatgttag

DBGET integrated database retrieval system