KEGG   Rattus norvegicus (rat): 366126
Entry
366126            CDS       T01003                                 

Gene name
Spi1
Definition
(RefSeq) transcription factor PU.1
  KO
K09438  transcription factor PU.1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04380  Osteoclast differentiation
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    366126 (Spi1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    366126 (Spi1)
   05202 Transcriptional misregulation in cancer
    366126 (Spi1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    366126 (Spi1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    366126 (Spi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    366126 (Spi1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    366126 (Spi1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 366126
NCBI-ProteinID: NP_001005892
RGD: 1359607
Ensembl: ENSRNOG00000012172
UniProt: Q6BDS1
Position
3
AA seq 271 aa
MLQACKMEGFPLVAPPSDELVTYESELYQRQTHDYYSLIGGDGDSHSDHYWDFSTHHVHS
EFESFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMAPPHASLSHQVSYMPRVCFP
YPPLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDL
LRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTG
EVKKVKKKLTYQFSGEVLGRGGLAERRLPPH
NT seq 816 nt   +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcgcccctccatcggatgagctg
gttacttatgaatcagaactataccaacgtcaaacacatgactactattccttgattggt
ggtgatggagacagccatagcgatcactattgggatttctccacacaccatgtacacagc
gagtttgagagcttccctgagaaccacttcacggagctgcagagcgtgcagcccccgcag
ctacagcagctctaccgccacatggagctggagcagatgcacgtccttgacacccccatg
gcaccgccccatgccagcctcagtcaccaggtttcctacatgccccgggtgtgcttccct
tatccacccttgtccccagcccaccagcagagctcagatgaggaggagggtgagaggcag
agccctccactggaggtgtctgatggagaagctgatggcttggagcctgggccaggcctt
ctgcatggggagacaggcagcaagaagaagattcgtttgtaccagttcctgctggacctg
ctgcgtagcggagacatgaaggacagcatctggtgggtggacaaggacaaaggtaccttc
cagttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggaaac
cgcaagaagatgacctaccagaagatggcgcgcgcgctgcgcaactacggcaagacgggc
gaggtgaagaaagtcaagaagaagctcacttaccagttcagcggcgaggtgctgggccgt
gggggcctggctgagcggcgcctcccgccccactga

DBGET integrated database retrieval system