KEGG   Rattus norvegicus (rat): 366140Help
Entry
366140            CDS       T01003                                 

Gene name
Fjx1
Definition
(RefSeq) four jointed box 1
  KO
K16674  four-jointed box protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Fam20C FAM198
Motif
Other DBs
NCBI-GeneID: 366140
NCBI-ProteinID: NP_001102425
RGD: 1306113
Ensembl: ENSRNOG00000005347
UniProt: D4AB25
Position
3q32
AA seq 449 aa AA seqDB search
MGRKMRGAAAAGLWLLALGSLLTLWGGLLPPRTELPASRPPEDRLPRHPIQSGGPAPEPR
FPLPPPLVWDARGGSLKTFRALLTLAAGADNPPGRHPDDRGRHVPSGLSWPAEHTAVHGG
VFWSRGLEEQVPRGFSEAQAAAWLEVARGARVVALDRGGCGRSSNRLARFADGTRACVRY
GINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGAQWVQVQEELRTAHWTEGSVVS
LTRWLPNLTDVVVPEPWRSEDGRLRPLRDAGGELTNLSQAELVDLVQWTDLILFDYLTAN
FDRLVSNLFSLQWDPRVMHRATSNLHRGPGGALVFLDNEAGLVHGYRVAGMWDKYNEPLL
QSVCVFRERTARRVLELHRGQDAAARLLRLYSRHEPRFPELAELADPHAQLLQRRLDFLA
KHILHCKAKYGRRPGDLITLRGREGLGYE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggggcggaagatgcggggcgccgccgccgcggggctctggctgctggctttgggctcg
ctgctaacgctgtggggagggctcctgccaccacggaccgagctgccagcctcccggccg
ccggaagatcgactccctcggcatccgatccagagtggcggccccgcgcccgagccgcga
ttccctctgcccccgcccctagtgtgggacgcccgcggcggctccctgaaaactttccgg
gcgctgctcaccctggcggccggcgcggataacccgcctgggaggcacccggacgatcgc
gggcggcacgtgccctccgggctgtcctggccagcggagcacacggcagtgcacgggggc
gtgttttggagccgcggcctggaggagcaggtgccccggggcttttccgaagcccaagca
gcagcttggctggaggtggcacggggagctcgggtggtggctctggatcgcgggggctgt
ggacgcagttccaaccgcctagcccgctttgccgacggcacccgtgcctgtgtacgctac
ggcatcaacccagagcagatacagggcgaggccctgtcctactaccttgcgcgcctgctg
ggcctccagcgccacgtgccgccgctggcactggctcgggtggaggctcggggcgcgcag
tgggtgcaggtgcaggaggagctgcgcacggcgcactggaccgagggcagcgtggtgagc
ctgacgcgctggctgcctaacctcaccgacgtggtggtgcccgagccctggcgatcagag
gacggccgtctgcggcccctgcgcgacgccgggggcgagctgaccaacctcagccaggcg
gagctggtggacctggtacaatggaccgatctgatcctcttcgattacctgacagccaac
ttcgaccggcttgtaagcaacctcttcagcttacagtgggacccacgcgttatgcaccgc
gctacaagcaacctgcaccgaggaccaggaggggcgttggtctttctggacaatgaggcg
ggcctggtgcacgggtaccgggtagccggcatgtgggacaagtataacgaaccgctgcta
cagtcggtgtgtgtattccgagagcggactgctaggcgcgtcttggagctgcaccggggt
caggacgcggcagcccggctcctgcgcctctacagtcgccacgaaccgcgtttcccagag
ctggcggagctcgcagacccccacgctcagctgctacagcgccgccttgacttcctcgcc
aaacacattttgcactgtaaggccaagtacggccgccgacccggggacttaataacactc
cgaggaagagagggactgggttatgaatga

DBGET integrated database retrieval system