KEGG   Rattus norvegicus (rat): 366142
Entry
366142            CDS       T01003                                 

Gene name
Elf5
Definition
(RefSeq) ETS-related transcription factor Elf-5
  KO
K17101  E74-like factor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    366142 (Elf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    366142 (Elf5)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    366142 (Elf5)
SSDB
Motif
Pfam: Ets SAM_PNT
Other DBs
NCBI-GeneID: 366142
NCBI-ProteinID: NP_001102426
RGD: 1305859
Ensembl: ENSRNOG00000008282
UniProt: D4A3N9
Position
3
AA seq 253 aa
MLDSVTHSTFLPNASFCDPLMSWTDLFNNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVW
EWLQFCCDQYKLDANCISFCHFNISGLQLCSMTQEEFIEAAGICGEYLYFILQNIRSQGY
SFFNDAEETKTAIKDYADSSCLKTSGIKSQDCHTRTNLQSSHLWEFVRDLLLSPEENCGI
LEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYK
FGKNAHGWQEEKL
NT seq 762 nt   +upstreamnt  +downstreamnt
atgttggactctgtaacccatagcaccttcctgcccaacgcttccttctgtgaccccctg
atgtcttggaccgatctgttcaacaatgaagaatattaccctgcctttgagcatcagaca
gcctgtgattcctactggacatcagtgcaccctgaatactggaccaagcgccatgtctgg
gaatggctccagttctgctgtgaccagtacaagctcgacgccaactgcatctccttctgt
cacttcaacatcagcggtctgcagctgtgcagcatgacgcaggaggagttcattgaggca
gccggcatctgtggggagtacctgtacttcatcctccagaacattcgctcacaaggttat
tcctttttcaacgatgctgaagagactaagaccgccatcaaagattatgctgattccagt
tgcttgaaaacaagtggcatcaagagtcaagactgtcacacccgaacaaacctccaaagt
tctcacctgtgggaatttgtcagagacttgcttctgtctcctgaagaaaactgtggcatc
ttggagtgggaagacagggagcagggcatcttccgagtggttaagtcagaagccctggca
aagatgtggggacaaaggaagaaaaacgacaggatgacgtatgaaaagttgagccgagcc
ctgagatactactataaaacgggaattttggagcgggttgaccggcggttagtgtacaaa
tttggaaaaaatgcgcacgggtggcaggaagagaaactatga

DBGET integrated database retrieval system