KEGG   Rattus norvegicus (rat): 366214Help
Entry
366214            CDS       T01003                                 

Gene name
Nkx2-2
Definition
(RefSeq) NK2 homeobox 2
  KO
K08029  homeobox protein Nkx-2.2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    366214 (Nkx2-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    366214 (Nkx2-2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    366214 (Nkx2-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 366214
NCBI-ProteinID: NP_001178833
RGD: 1308443
Ensembl: ENSRNOG00000012728
UniProt: D3ZDQ2
Position
3q41
AA seq 273 aa AA seqDB search
MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQSALDAVQSLP
LKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQG
GGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHR
YKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQ
SLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgaccaacacaaagacggggttttcagtcaaggacatcttggaccttccggac
accaacgatgaagaaggctcggtggccgaagggccggaggaggagaacgaagggccggag
ccggccaagagggccgggccgctagggcagagcgccttggatgctgtgcagagcctgccc
cttaagagtcctttctacgacagcagcgacaacccctacactcgctggctggccagcacc
gagggcctccaatactccctgcacggactggcggcgagcgctcccccccaagactcgagc
tccaagtccccagagccctcggctgacgagtcaccggacaatgacaaggagacccagggc
ggcgggggggacgcaggcaagaagcggaagcgccgagtgctcttctccaaagcgcagacc
tacgagctggagcggcgcttccggcagcagcggtacctgtcggcgcccgagcgcgagcac
ctggccagcctcatccgtctcacgcccacgcaggtcaagatctggttccaaaaccatcgc
tacaagatgaaacgtgcccgggctgagaaaggtatggaggtgacgcctctaccctcgccg
cgccgtgtggcagtgccggtcttggtcagggacggcaaaccgtgccacgcgctcaaagcc
caggacctggcagctgccaccttccaggcaggcatccccttttccgcctacagcgcgcag
tcgctgcagcacatgcaatacaacgcccagtacagctcggccagcaccccccagtacccg
acagcacaccccctggtccaggcccagcagtggacttggtga

DBGET integrated database retrieval system