KEGG   Rattus norvegicus (rat): 366232Help
Entry
366232            CDS       T01003                                 

Gene name
Rem1
Definition
(RefSeq) RRAD and GEM like GTPase 1
  KO
K07847  Rad and Gem related GTP binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    366232 (Rem1)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Rad/Gem/Kir [OT]
    366232 (Rem1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf FeoB_N RuvB_N AAA_22 RsgA_GTPase AAA_16 ABC_tran AAA_18 AAA AAA_24 AAA_5 AAA_28 MMR_HSR1 NACHT NTPase_1 DUF2369
Motif
Other DBs
NCBI-GeneID: 366232
NCBI-ProteinID: NP_001020924
RGD: 1306560
Ensembl: ENSRNOG00000007567
UniProt: Q4KLY1
Position
3q41
AA seq 297 aa AA seqDB search
MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPPAQSQHPRLGQSASLNPPIRKPS
PAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQERDLHEQLGGVYERTL
SVDGEDTTLVVMDTWEAEKLDESWSQESCLQAGSAYVIVYSIADRSSFESASELRIQLRR
THQAAHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVR
QLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARRRALKARSKSCHNLAVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgactcttaacacccagcaggaagcaaagaccactctgcgacgtcgagccagcacacca
ctacccctgtcgtccaggggccaccagcctggccgcctgtgcacagcaccccctgctcaa
tcccagcatccccgactgggtcagtcagcctccctcaaccctcccattcggaaaccctcc
cctgcccaggatgggtggtcctctgaatccagcgactctgaaggctcttgggaggcactc
taccgggtggtgcttcttggagaccccggtgtcgggaagactagcttggccagcctcttt
gcagagaaacaagaacgagaccttcacgagcagctgggaggtgtgtatgagagaacgctg
tcggtggacggagaggacaccacactggtggtcatggacacctgggaggctgagaaactg
gatgaaagctggagccaggagtcatgcctgcaggcgggcagcgcctatgtcatcgtgtac
tccatcgcagatcgcagcagctttgagagtgcctccgagctccgaatccagctgaggcgc
acgcaccaggccgcccatgtgcctatcatcctggtgggcaacaaggccgacctggctcgt
tgccgagaagtctctgtagaagagggccgcgcctgcgctgtggtgttcgactgcaagttc
atcgagacctcagccactctgcagcacaacgtgacagagctcttcgaaggtgtggtgcgc
caactgcgcctgcgccgccaagacaatgcggccccggagacaccttcacctcgacggcgg
gccagcttgggccagcgtgcccgccgcttcctggcacgcctgacagcacgcagcgcacga
cgccgggcactcaaagcccgctccaagtcctgccacaacctggctgtgctctga

DBGET integrated database retrieval system