KEGG   Rattus norvegicus (rat): 366274Help
Entry
366274            CDS       T01003                                 

Gene name
Ntsr1, Ntsr
Definition
(RefSeq) neurotensin receptor 1
  KO
K04211  neurotensin receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    366274 (Ntsr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    366274 (Ntsr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    366274 (Ntsr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Neurotensin
    366274 (Ntsr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srv 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 366274
NCBI-ProteinID: NP_001102437
RGD: 1306076
Ensembl: ENSRNOG00000028708
UniProt: P20789
Structure
PDB: 

Position
3q43
AA seq 424 aa AA seqDB search
MHLNSSVPQGTPGEPDAQPFSGPQSEMEATFLALSLSNGSGNTSESDTAGPNSDLDVNTD
IYSKVLVTAIYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLA
MPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTL
MSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSGDGTHPGGLVCTPIVDTATVKVVIQV
NTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRVCTVGTHNGLEHSTFNMTIEPGRV
QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV
SSAINPILYNLVSANFRQVFLSTLACLCPGWRHRRKKRPTFSRKPNSMSSNHAFSTSATR
ETLY
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcaacagctccgtgccgcagggcacccctggtgaacccgatgcccagcccttt
tcgggaccacagtccgaaatggaagcgacgttcctggcgctcagtttgagcaatggttct
ggcaatacctcggaatccgacacggcagggcccaacagcgacctggacgtgaacactgac
atttattccaaggtgctggtgactgctatatacctggcactcttcgtggtgggcactgtg
ggcaactccgtgacagccttcactctagcgcggaagaagtcactgcagagcctgcagagc
actgtgcattaccacctgggcagcctggcactgtctgacctgcttatccttctgctggcc
atgcccgtggagctatacaacttcatctgggtacaccatccctgggcctttggggacgct
ggctgccgtggctactatttcctgcgtgatgcctgcacctatgccacagccctcaatgta
gccagcctgagtgtggagcgctacttggccatctgccatcccttcaaggccaagaccctc
atgtcccgcagccgcaccaagaaattcatcagtgccatatggctagcttcggcgctgctg
gctatacccatgcttttcaccatgggcctgcagaaccgcagtggtgacggcacgcaccct
ggcggcctggtgtgcacacccattgtggacacagccactgtcaaggtcgtcatccaggtt
aacaccttcatgtccttcctgtttcccatgttggtcatctccatcctaaacaccgtgatt
gccaacaaactgacagtcatggtgcaccaggccgccgagcagggccgagtgtgcaccgtg
ggcacacacaacggtttagagcacagcacgttcaacatgaccatcgagccgggtcgtgtc
caggccctgcgccacggagtcctcgtcttacgtgctgtggtcattgcctttgtggtctgc
tggctgccctaccacgtgcgacgcctgatgttctgctatatctcggatgaacagtggact
acgttcctcttcgatttctaccactatttctacatgctaaccaacgctctcttctacgtc
agctccgccatcaatcccatcctctacaacctggtctccgccaacttccgccaggtcttt
ctgtccacgctggcctgcctttgtcctgggtggcgccaccgccgaaagaagaggccaacg
ttctccaggaagcccaacagcatgtccagcaaccatgccttttccaccagcgccacccgg
gagaccctgtactag

DBGET integrated database retrieval system