KEGG   Rattus norvegicus (rat): 366277
Entry
366277            CDS       T01003                                 

Gene name
Polr3k
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC10
  KO
K03019  DNA-directed RNA polymerase III subunit RPC11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    366277 (Polr3k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    366277 (Polr3k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    366277 (Polr3k)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     366277 (Polr3k)
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Lar_restr_allev Nudix_N_2 zf-SAP30 Baculo_LEF5_C Zn_ribbon_recom
Other DBs
NCBI-GeneID: 366277
NCBI-ProteinID: NP_001014281
RGD: 1587294
Ensembl: ENSRNOG00000017843
UniProt: Q5FVH1
Position
3
AA seq 108 aa
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
NVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
NT seq 327 nt   +upstreamnt  +downstreamnt
atgctgctgttctgcccgggctgcgggaacggcctcattgtggaggaggggcagcgctgt
caccgcttcgcctgcaacacgtgcccgtacgtccataacatcacccgcaaggtaacaaac
cgaaagtatccaaagctaaaagaagtggatgatgtgcttggtggagcagctgcctgggag
aatgtggactctactgcagagccatgtccaaaatgtgagcatcctcgtgcctacttcatg
cagcttcagacccgttctgcggacgagccaatgaccaccttctataagtgctgcaatgct
cagtgtggacatcgctggagggattag

DBGET integrated database retrieval system