KEGG   Rattus norvegicus (rat): 366311
Entry
366311            CDS       T01003                                 

Gene name
Clvs1
Definition
(RefSeq) clavesin-1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CRAL_TRIO CRAL_TRIO_2 CRAL_TRIO_N
Other DBs
NCBI-GeneID: 366311
NCBI-ProteinID: NP_001102439
RGD: 1564200
Ensembl: ENSRNOG00000006919
UniProt: A6JFQ6
Position
5
AA seq 354 aa
MGPVSVLPKPQSISTWEGDLAKMTHLQAGLSPDTIEKARLELNENPDVLHQDIQQVRDMI
ITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKR
ALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGF
ILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFL
KDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWARTLLGPDYSDENDYTH
TSYNAMYVKHTCSNLERECSPKPMKRSQSVVEAGTLKHEEKGENENTQPLLALD
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaccagtttctgttcttcccaaacctcagagcataagcacttgggaaggagatttg
gccaagatgacacatttgcaggccgggctcagtccagacacgatagagaaagctcgcctg
gaactgaatgaaaacccagatgttttacatcaggacattcaacaggtcagagacatgatc
atcaccaggccagacattggatttttacgtacagatgatgccttcatcctgcggtttctc
cgagccaggaagtttcaccaagccgatgccttcagactcctggcccagtattttcagtac
cgccagctaaacctggacatgttcaaaaactttaaggcagacgatcccgggattaagagg
gctttgatcgatggattccccggagtgttggaaaatcgtgaccactacggcaggaagatt
ctcctgctgtttgctgccaattgggatcagagtaggaactccttcacagacatccttcgc
gccattctcctgtccttggaagtccttatcgaagatcctgagctccagataaatggtttc
attttaattatagactggagtaatttttccttcaaacaagcctccaagctgacaccgtcg
atcctgaaactggccattgaagggctgcaggacagctttcctgctcgctttggaggagtc
cattttgtcaaccagccctggtacatccatgccctgtacacgctcatcaagccattcctc
aaagacaagacaagaaaacggattttcctacatgggaacaacttgaacagccttcaccag
ctaatacaccctgagtttctgccctctgaatttggaggaactcttcctccttatgacatg
gggacttgggcccggacattacttggccctgactacagcgatgaaaatgactatacccac
acttcctacaatgccatgtatgtgaaacacacctgctccaacctggagagagagtgctcg
cccaagcccatgaaaagatctcagtccgtggtagaagctgggaccttgaaacatgaagag
aagggggaaaacgagaacacccagccactgctggctctggactga

DBGET integrated database retrieval system