KEGG   Rattus norvegicus (rat): 366441Help
Entry
366441            CDS       T01003                                 

Gene name
Slc5a9
Definition
(RefSeq) solute carrier family 5 member 9
  KO
K14389  solute carrier family 5 (sodium/glucose cotransporter), member 9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    366441 (Slc5a9)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   366441 (Slc5a9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF OppC_N
Motif
Other DBs
NCBI-GeneID: 366441
NCBI-ProteinID: NP_001102444
RGD: 1311383
Ensembl: ENSRNOG00000042950
UniProt: D3ZG11
Position
5q35
AA seq 574 aa AA seqDB search
MSKELAAMEPGASRDGLRAETTHQALGSGVSLHTYDIVVVVIYFVFVLAVGIWSSIRASR
GTIGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATFLLLAL
GWIFVPVYIAAGVVTMPQYLKKRFGGQRIQVYMSVLSLILYIFTKISTDIFSGALFIQMA
LGWNLYLSTVILLVVTAVYTIAGGLTAVIYTDALQTVIMVGGALVLMFLGFREVGWYPGL
QQLYRQSIPNVTVPNTTCHLPRSDAFHMLRDPVNGDIPWPGLIFGLTVLATWCWCTDQVI
VQRSLSAKSLSHAKGGSVLGGYLKILPMFFIVMPGMISRALYPDEVACVDPDICQRVCGA
RVGCSNIAYPKLVMALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFAIDVWQRVRRQA
SEQELMVVGRLFVVFLVLISILWIPIIQSSNSGQLFDYIQSITSYLAPPITALFLLAIFC
KRVTEPGAFWGLMFGLVVGILRMILEFSYSAPACGEKDRRPAVLKDFHYLYFALLLCGLT
AIIIVIISFFTEPIPDEKASSCSPDLVDKELSHI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggagctagcagcaatggaacctggagcttcaagggatggactcagagctgag
acaacacaccaagccctgggctctggagtcagcctgcacacctatgacatcgtggtggtg
gtcatctactttgtctttgtccttgctgtgggaatttggtcgtccatccgcgcaagccga
gggaccattggtggctatttcctggctggaagatccatgacctggtggccaattggagca
tctctaatgtccagcaatgtgggcagtggcttattcatcggcctggctggaacaggggct
gctggaggccttgctgtgggtggcttcgagtggaatgcaacttttctgcttctggccctg
ggctggatctttgtccctgtgtacatcgcagctggtgtggtcaccatgccacagtacctg
aagaaacgatttggggggcagaggatccaggtgtacatgtcagtcctgtctctcatactc
tacatcttcaccaagatatcgactgatatcttctctggagccctcttcatccagatggcc
ttgggctggaatctctatctctccacagtcatcctgctggtggtgacagctgtctacacc
attgcagggggcctcacagctgtgatctacacagatgctctacagaccgtgatcatggtt
gggggagccctggtcctcatgtttctgggctttcgggaggtcggctggtacccaggcttg
cagcagctctatagacagtccatccccaatgtcacagttcccaacactacctgtcacctc
ccacggtctgatgccttccacatgcttcgagatcctgtgaacggggacatcccctggcca
ggtcttatttttggcctcacagtcttggccacctggtgttggtgcacggaccaggtgatt
gtgcagaggtctctctcggccaagagtctttcacatgccaagggaggatcagtgttaggg
ggctacctaaagatcctcccaatgttcttcattgtcatgcccggcatgatcagcagggcc
ctgtacccagatgaagtcgcctgtgtggaccctgacatctgtcagagagtgtgtggggcc
agagttggatgctccaatattgcctaccccaaacttgttatggctctcatgcctgtgggt
ctgcgaggcctgatgattgccgtgatcatggctgccctcatgagctcactcacctccatc
ttcaacagcagtagcaccctgtttgccatagatgtgtggcagcgagtccgcaggcaggca
tcggagcaagagctgatggtggtaggcaggttgtttgtagtcttcctggtactcatcagc
atcctctggatccccatcatccagagctccaatagtgggcagctctttgactacatccaa
tccatcaccagctacctagccccgcccatcacagccctcttcctgctggccatcttctgc
aagagggtcactgagcctggtgccttctggggcctcatgtttggcctggtagtgggaata
ctgcgtatgattctggagttctcatactcagccccagcctgtggggagaaggacaggcgg
ccagctgttcttaaggacttccactacctgtactttgccctcctcctctgtggacttacc
gccatcatcattgtcataatcagcttcttcacggagcccatccccgacgaaaaggcaagt
tcttgctcgcctgacctggtggacaaggagctgtcccatatctga

DBGET integrated database retrieval system