KEGG   Rattus norvegicus (rat): 366473Help
Entry
366473            CDS       T01003                                 

Gene name
Azin2, Adc, AzI2, ODC-p, RGD1564776
Definition
(RefSeq) antizyme inhibitor 2
  KO
K01583  arginine decarboxylase [EC:4.1.1.19]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
Module
rno_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    366473 (Azin2)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     366473 (Azin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 366473
NCBI-ProteinID: NP_001014283
RGD: 1564776
Ensembl: ENSRNOG00000051507
UniProt: Q6AYN0 F5A6B1
Position
5q36
AA seq 459 aa AA seqDB search
MAGYLSESDFVMVEEGFSTRDLLEELTLGASQATTGKVAAFFVADLGAVVRKHFCFLKYL
PRVRPFYAVRCNSSLGVLKVLAELGLGFSCASKAEMELVQHIGVPASKIICANPCKQVAQ
IKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLNHLSLRFGASLKSCRH
LLENAKQSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGAELGHTMNILDLGGGFP
GLEGAKVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKKEVLDQ
PSREEQTGAAPKSIVYHLDEGVYGVFNSVLFDNTCPTPALQKKPSADQPLYSSSLWGPAV
DGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKSLLGGTQACRVTYAMSRLAWEALQGQ
LLPAEEDQDAEGVCKPLSCGWEITDSLCVGPVFTPASIM
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggctggctacctcagtgaatcggactttgtgatggtggaggagggcttcagcacccgg
gatctgctggaggaactcactctgggggcctcccaggccaccacgggcaaggtggctgcc
ttcttcgtggccgacctgggtgctgtagtgaggaagcacttctgctttctgaagtacctg
cctcgagtccggcctttttatgctgtcaggtgcaacagcagtcttggcgtgctgaaggtc
ctggccgagctgggactgggcttcagctgtgccagcaaggcagagatggagttggtccag
cacattggtgtccctgccagtaagatcatctgtgccaacccctgtaagcaagttgcccag
atcaagtatgctgccaagcacggggtgagactgctaagcttcgacaatgaagtggaactg
gccaaggtggtcaagagccaccccagtgccaagatggttctgtgcattgctacccaggac
tcccactctctgaatcacctgagcttgaggttcggggcgtcgctgaaatcctgcagacat
ctgctcgagaacgccaagcagagccatgtggaggtggtgggtgtgagttttcacattggt
agtggctgtcctgaccctcaggcctatgcccagtccatcgcggatgccaggctcgtgttt
caaatgggtgcggagctgggccacacgatgaacatcctggaccttggcggcggctttcct
ggcttagagggagccaaagtgagatttgaagagatggcctcagtgattaactcagccttg
gacctgtacttccctgagggctgcggtgtggacatccttgctgagctgggccgctactat
gtgacgtcagccttcactgtggccgtcagcatcgttgccaagaaggaggttctggaccag
cccagcagggaggagcaaaccggcgcagcccctaagagcatcgtgtaccaccttgatgaa
ggtgtttatggggtcttcaactcagtcctgtttgacaacacctgccccacccccgccctg
cagaagaaaccatctgcggatcaaccgctgtacagcagtagcctgtggggcccagcagtt
gacggctgcgactgtgtggctgagggcctatggctgccgcaactacaagtaggggactgg
ctggtctttgacaacatgggtgcttacaccgtggacacaaagtcccttctcggggggacc
caggcctgcagagtcacttatgccatgtcccggctagcctgggaagcccttcaagggcag
ctgctgcctgcagaagaagaccaggacgccgagggtgtgtgcaaacctctgtcctgcggc
tgggagatcacagacagcctgtgtgtgggccctgtcttcaccccagcaagcatcatgtga

DBGET integrated database retrieval system