KEGG   Rattus norvegicus (rat): 366518
Entry
366518            CDS       T01003                                 

Gene name
Tnfrsf14
Definition
(RefSeq) TNF receptor superfamily member 14
  KO
K05152  tumor necrosis factor receptor superfamily member 14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    366518 (Tnfrsf14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    366518 (Tnfrsf14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    366518 (Tnfrsf14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    366518 (Tnfrsf14)
   04090 CD molecules [BR:rno04090]
    366518 (Tnfrsf14)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   366518 (Tnfrsf14)
CD molecules [BR:rno04090]
 Proteins
  366518 (Tnfrsf14)
SSDB
Motif
Pfam: TNFR_c6 DAG1 DUF4381
Other DBs
NCBI-GeneID: 366518
NCBI-ProteinID: NP_001015034
RGD: 1310115
Ensembl: ENSRNOG00000013820
UniProt: Q5BK53
Position
5q36
AA seq 278 aa
MEPLPGWESSPWSRADNTFRLVPCVFLLNLLQCISAQPLCRQEEFSVGDECCPMCNPGYH
VKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCI
SGYFCENQDGGACSTCLPHAACPPGQRVQKRGTYSHDTVCADCLTGTFSLGGTQEECLPW
TKCSTFQREVKHGTSSTDTTCSFQTFYIVVVIVGVAIVGAGVVVFLLRKQRQRHTSIVAS
ELEAFQQEQQEDAIRFPVIEVGPSVTEEEAAFNCMNSG
NT seq 837 nt   +upstreamnt  +downstreamnt
atggaacctctcccgggatgggagtcgtcaccctggagccgggcagacaacaccttcagg
ctggtgccgtgtgtcttccttttgaacttgttgcagtgtatctctgcccagcccttgtgc
agacaggaggagttttctgttggggatgagtgctgccccatgtgcaatccaggttaccat
gtgaagcaggtctgcagtgagcatacaggcacagtgtgtgccccctgtcccccacagacc
tataccgcccatgcgaatggcctgagcaagtgtctgccctgcggagtctgtgatccagac
atgggcctgctgacctggcaggagtgctccagctggaaggacactgtgtgcagatgcatc
tcaggttacttctgtgagaaccaggatgggggcgcctgttccacatgcttgcctcacgcc
gcctgccctccaggacagagggtacagaagagaggtacttacagccatgacactgtatgt
gctgactgcctgacaggaaccttctcacttggcgggactcaggaggaatgcctgccctgg
accaagtgcagtacctttcaacgggaagtaaaacatgggaccagcagcacagacaccacc
tgctccttccagaccttctacatcgtcgttgtgatagtgggagttgcgatagtgggagct
ggggtagttgtattcctcctccgcaagcaaagacagcggcataccagcatagtggccagt
gagctggaggctttccagcaggagcaacaagaggacgccatcaggtttccagtcatcgag
gttggtccttctgtgaccgaggaggaggcagccttcaactgcatgaattcggggtga

DBGET integrated database retrieval system