KEGG   Rattus norvegicus (rat): 366531
Entry
366531            CDS       T01003                                 

Gene name
Ttc39d, RGD1311615
Definition
(RefSeq) tetratricopeptide repeat domain 39D
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF3808 TPR_12 TPR_2 TPR_1
Other DBs
NCBI-GeneID: 366531
NCBI-ProteinID: NP_001178835
RGD: 1311615
Ensembl: ENSRNOG00000027343
UniProt: D4A7N7
Position
6q11
AA seq 604 aa
MSRYQRHEDNDEYLLNTLSLSEGETERMARVTRSVNLRDSETEDKFEDAHEIIPVATTMS
LLSSLEECTTGLYLFLNNRFSDAINLIHPWSKNSSYHALIYSMFMVVKAILTFEPQDIQI
GMNAAKEALKTCNNFRKKPRIMTLSRLVSRQGIKSIKEEELHAEVCYAECLVLKSAITFI
QDDSLLNFLKSGVNVGSSYQIYKDCQQVLELMPENQSKTHRHLNGGIKFGVGVFNLMFSL
VPPKSLKLLNMVGYSGDREVGLALLHDSASEPHINNILSVFTLLFYYNYVRVVVGVEKAS
TAATESLFLVYLEKFPNCVVLKFFRARFNMLNGNFESAKLKLQECIITQNEWKQVHHLCY
WELMWCHIFLQNWKQAYNYANLLFQHSRWSKAIYTYSKAIILALLPPDSVDSENESLSSY
FLRVDSLRIKFLGSSVPIEKFIAEKSQRYGTTTGWFTAQPLLEFIYAWSGFRVMSKKIEL
ISSWLMIIDKGKELLNENPNEEYGVDDMSLLNLLKGLCLKHLGKHLKAEHYFIRVIRKER
SLKYDHYLVPYSYYELGMLHYLKGDYTNATKNLDNIKNYKDYSMEARLQFRAHIALEQIA
KLEK
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgtcacggtaccaaagacatgaggacaatgacgagtacctgttaaatacccttagtctg
agtgaaggcgaaactgaaagaatggcaagagtaactagatcagtcaatctcagggacagt
gaaacagaggacaagtttgaggatgcccatgaaattatccctgtggcaacaacaatgagc
ctcttgtcctccttggaagaatgcacaactggattgtatttgtttctaaataacagattc
tcagacgccatcaatcttattcacccatggtcaaaaaacagttcctatcatgccctaata
tacagtatgtttatggttgtcaaggccatcctcacttttgagccacaggatatccagatc
ggaatgaatgctgcaaaggaagctctgaaaacctgcaacaatttccggaaaaaacccagg
ataatgactttatctcgcctagtgagtaggcagggaataaagtctatcaaagaggaggag
ttacacgcagaagtatgctatgccgagtgtctagtcttgaagtctgccataacgtttata
caggacgacagtttgctgaacttccttaaaagcggtgtcaatgttgggtcaagctatcaa
atatacaaagactgccagcaggtcttagaacttatgccggagaaccaaagtaaaacccac
agacacctaaatggagggataaaatttggagttggagtattcaatctgatgttttcactt
gttccaccaaaatcacttaaacttctcaatatggttggctattctggagacagagaagtg
gggctggctttgcttcacgacagtgcatcggaaccccatataaataacatcttaagtgtg
ttcactcttctcttttattacaactacgtgcgtgtagttgttggtgttgaaaaggcttct
actgctgctacagagagtctcttcctggtctacctggagaaattccccaactgtgttgta
cttaaattttttcgtgcacgttttaacatgctaaatggaaattttgaaagtgcaaagtta
aagttacaagagtgcattattactcagaatgaatggaagcaggttcatcacctctgttac
tgggaactcatgtggtgccatatttttttgcagaattggaagcaggcatacaactatgcc
aatctattgtttcaacacagcaggtggtctaaggcgatctatacatacagcaaagccata
atactggccttgcttcctcctgattccgtggactcagaaaacgagagcttgagctcctac
ttcttacgtgtggatagcctgagaatcaaatttttaggctcttctgtgccgatagaaaag
tttattgctgagaagagtcagcgctatggtactacaacgggctggtttacagcacagccc
cttctggaattcatctacgcctggagtgggttccgagtcatgagcaagaaaatagagctt
atttcaagttggctaatgataattgacaaaggaaaagagcttttgaatgagaatccaaat
gaggagtatggtgtggacgacatgagcttgctaaatttgctgaaaggcctgtgcctgaag
cacctgggcaaacacctgaaggctgaacactacttcatccgtgtgatcaggaaggaaagg
tcattaaagtacgaccactatctggtgccctatagctactatgaactgggaatgctacac
tatctgaaaggagactatactaatgcaaccaaaaacctcgacaacataaagaactataag
gactattccatggaggcccggctacagtttagggctcatattgcccttgaacagatagct
aaattagaaaagtga

DBGET integrated database retrieval system