KEGG   Rattus norvegicus (rat): 366618Help
Entry
366618            CDS       T01003                                 

Gene name
Ap4s1
Definition
(RefSeq) adaptor-related protein complex 4, sigma 1 subunit
  KO
K12403  AP-4 complex subunit sigma-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    366618 (Ap4s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    366618 (Ap4s1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    366618 (Ap4s1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s
Motif
Other DBs
NCBI-GeneID: 366618
NCBI-ProteinID: NP_001124471
RGD: 1311990
Ensembl: ENSRNOG00000005765
UniProt: B0BN62 F1M5X2
Position
6q23
AA seq 144 aa AA seqDB search
MIKFFLMVNRQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEYKDFKLIYR
QYAALFVVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKMSES
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagttcttccttatggtgaacagacaagggcagacccggctgtctaagtactat
gagcatgtagacattaataaacgtgcacttctggaaaccgaggtcagcaagagctgcctg
tcccgatccagtgaacaatgctcgttcattgaatacaaggatttcaaattgatctaccgg
caatacgcagctctctttgttgtggttggagttaatgacacggagaatgagatggctatc
tatgaattcatacacaattttgtggaagttttagatgaatacttcagcagagtgagtgaa
ctagatataatgtttaatttggacaaagtccacatcattttggatgagatggtgttaaat
ggctgcattgtggaaactaacagagcaagaattcttgccccgctactgattcttgacaag
atgtcggagagctga

DBGET integrated database retrieval system