KEGG   Rattus norvegicus (rat): 366624
Entry
366624            CDS       T01003                                 

Gene name
Cfl2
Definition
(RefSeq) cofilin 2
  KO
K05765  cofilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05133  Pertussis
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    366624 (Cfl2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    366624 (Cfl2)
  09158 Development and regeneration
   04360 Axon guidance
    366624 (Cfl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    366624 (Cfl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    366624 (Cfl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    366624 (Cfl2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    366624 (Cfl2)
   04147 Exosome [BR:rno04147]
    366624 (Cfl2)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    366624 (Cfl2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     366624 (Cfl2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   366624 (Cfl2)
SSDB
Motif
Pfam: Cofilin_ADF Ribosomal_S2
Other DBs
NCBI-GeneID: 366624
NCBI-ProteinID: NP_001102452
RGD: 1306982
Ensembl: ENSRNOG00000045892
UniProt: M0RC65
Position
6q23
AA seq 166 aa
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGSVVVSLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcatctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta
agaaaatcttctacccaggaggagatcaaaaaaagaaagaaagcagttctcttctgttta
agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt
ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc
cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta
tttatattctgggctcctgaaagtgcaccgttaaaaagcaagatgatttatgctagctct
aaagatgccattaaaaagaaatttacaggtattaaacatgagtggcaagtaaatggcttg
gacgatattaaggaccgctcgacactgggagagaaactgggaggcagtgttgtagtttcc
ctggaaggaaagccactgtaa

DBGET integrated database retrieval system