KEGG   Rattus norvegicus (rat): 366668
Entry
366668            CDS       T01003                                 

Gene name
Gphb5, Gpb5
Definition
(RefSeq) glycoprotein hormone beta 5
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Cys_knot DAN
Other DBs
NCBI-GeneID: 366668
NCBI-ProteinID: NP_001007014
RGD: 1359264
Ensembl: ENSRNOG00000021885
UniProt: Q5VJF5
Position
6q24
AA seq 129 aa
MKLVYLVLGTAALLLGGSDSVLSSSSGNLHTFVGCAVREFTFVAKKPGCRGLRITTDACW
GRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACS
TATTECETI
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaagctggtataccttgtccttggtactgcggccctccttctgggtggctctgactct
gtcctcagcagctccagcgggaacctacacacttttgtgggatgtgctgtgagggaattc
acttttgtggccaagaagccaggctgcaggggacttcggatcaccacagatgcctgctgg
ggtcgctgtgagacctgggagaaacccattctggagcctccctacatagaagcctatcat
cgagtgtgtacctacaatgagaccagacaggtgacggtgaagctgcctaactgtgcccct
ggagtcgaccccttctacacctaccctatggctgtccgatgtgactgcggggcatgttcc
actgccaccactgagtgtgagaccatctga

DBGET integrated database retrieval system