KEGG   Rattus norvegicus (rat): 366790
Entry
366790            CDS       T01003                                 

Gene name
Pym1
Definition
(RefSeq) partner of Y14 and mago
  KO
K14294  partner of Y14 and mago
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    366790 (Pym1)
   03015 mRNA surveillance pathway
    366790 (Pym1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    366790 (Pym1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     366790 (Pym1)
SSDB
Motif
Pfam: Mago-bind DUF3043 Nif11
Other DBs
NCBI-GeneID: 366790
NCBI-ProteinID: NP_001102456
RGD: 1306096
Ensembl: ENSRNOG00000058130
UniProt: D3ZGY1
Position
7
AA seq 203 aa
MKTSSTPEATGTGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELP
PGLSPEATTQVTPSRPDSGEAGLSKTAKRNLKRKEKRRQQQEKDAEALSRTLDKVSLGDS
AQMPSAHHGPQATPPAASDAPDSAATTEKAKKIKNLRKKLRQVEELQQRIQAGEISQPSR
EQLEKLARRRVLEEELEDLELGL
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaaaacctccagcacccctgaggccacgggcacaggcaagtacattgcctcaacacag
agacccgacgggacatggcgcaagcaacggagggtcaaagaaggatacgtgccccaagag
gaggtcccagtctatgaaaacaagtatgtgaagtttttcaagagtaaaccggaacttccc
ccagggctgagccctgaggccaccacacaggtcacaccatccagacctgacagtggtgaa
gcaggcctctccaagacagccaaacgcaacctgaagcggaaggagaagaggaggcagcag
caggagaaagacgcggaggccttgagcaggactcttgataaggtgtctctgggagactca
gcccagatgcccagtgctcaccatggcccccaagccacccctccagctgcctccgatgca
cctgactctgctgccaccacagagaaagccaagaagatcaagaacctgaggaagaagctg
cgacaggtggaggagctgcagcagcgcatccaggccggggagatcagccagcctagcaga
gagcagctggagaagctggcacggcggagggtgctggaggaggagctggaggacttggag
ttgggcctgtga

DBGET integrated database retrieval system