KEGG   Rattus norvegicus (rat): 366791
Entry
366791            CDS       T01003                                 

Gene name
Rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    366791 (Rdh5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     366791 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 366791
NCBI-ProteinID: XP_008763278
RGD: 1308849
Ensembl: ENSRNOG00000053850
UniProt: A0A0G2K1R4
Position
7
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDRQSLPARDAVIFITGCDSGFGRLLALQLDQKGFQVLAGCL
TPSGAEDLQQMASSRLHTTLLDITDPQNVQQVAKWVKTRVGETGLFGLVNNAGVAGIIGP
TPWLTQDDFQRVLNVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRIAANGGGYCVSKF
GLEAFSDSLRRDMAPFGVQVSIVEPGFFRTPVTNLESLENTLKACWARLPPATQAHYGEA
FLTTYLQVQRRIMNLICDPDLTKVTSCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAR
VVDAVLAWVLPRPAQSIY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgcttctgggtgccttgctgtgggcagtactgtggttgctcagagac
cggcagagcctgccggcccgagacgctgtcatcttcatcaccggctgtgactcgggcttt
gggcgccttctggcactgcaacttgaccagaagggcttccaagtgctggccggctgcctg
accccctctggggcagaagacctacaacagatggcctcctcccgcctccacacaacactg
ctggatatcactgatccccagaatgtccagcaagttgccaagtgggtgaagacacgtgtt
ggagaaactgggctctttggtctggtgaataacgctggtgtagctggtatcatcgggccc
acaccatggctgacacaggatgatttccagagagtgctgaatgtgaacacactgggcccc
attggggtcacccttgccctgctgcccctgctacaacaggccagggggcgggtggtcaac
atcaccagtgtcttgggccgaatagcagccaatggcgggggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggacatggctccatttggagtacaagtc
tccattgtggagcctggcttcttccgaaccccagtgaccaacctggagagtctggagaac
accctgaaggcttgttgggcccggctacctccagctacacaggcccactacggagaagcc
ttcctcactacttatcttcaagtgcagcgccgcatcatgaacctaatctgtgacccagac
ctaacgaaggtgacaagctgcctggagcatgccctgactgcccgccatccccgaacacgg
tacagcccaggctgggatgccaagcttctctggctgcctgcctcctaccttccagccagg
gtggtggatgctgtgctcgcctgggtccttccccggcctgcccagtcaatctactga

DBGET integrated database retrieval system