KEGG   Rattus norvegicus (rat): 366798Help
Entry
366798            CDS       T01003                                 

Gene name
Olr921
Definition
(RefSeq) olfactory receptor 921
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    366798 (Olr921)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    366798 (Olr921)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    366798 (Olr921)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 366798
NCBI-ProteinID: NP_001001385
RGD: 1333844
Ensembl: ENSRNOG00000050939
UniProt: D3ZC13
Position
7q11
AA seq 311 aa AA seqDB search
MRNRTVTTFILLGLTDDIRLQILLFMFLILSYMLSLSGNLTIITLTLIDPHLKTPIYIFL
KNFSFLEISLTTACIPRFLYSISSGDKSITYIACASQLLFIDLFAVTEFFLLAIMSYDRY
VAICKPLHYMTIMNSRVCKNFIFFCWVAALIIILPPIGLGLRLEFCDSNIIDHFCCDAAP
LLKISCSDTLLIEQMVIVGAVFTFIITFVCVVLSYVYIIKTILRFPSAKQRKKAFSTCSS
HMIVVSIAYGSCIFIYVKPSSKDDVAINKGISLIIISISPMLNQFIYALRNNQVKQAFNY
SIKKLAFLSNM
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcgaacagtaacaaccttcattttgctgggtctcacagatgacattcgactt
caaattctgcttttcatgtttctgatcctttcttacatgttgagtttatctggcaaccta
accatcatcactctcactctgattgacccccatcttaaaacacctatatatattttcctc
aaaaatttctctttcttagaaatctcactcacaactgcttgtattcccagatttctatac
agcatatcatctggggacaagtccattacctatattgcttgtgccagtcaactgctgttt
atagatctctttgcagttacagaattttttctccttgctatcatgtcctatgatcgatat
gtggccatctgtaaacctctgcactacatgaccatcatgaatagcagggtctgcaagaat
ttcatcttcttctgttgggtagcagcactgatcatcattctcccaccaattggtctaggc
ttacgcctggaattctgtgactctaatatcattgaccatttttgttgcgatgcagctcct
ctcttgaaaatctcttgttcagacacattgttaatcgaacagatggtaatagttggtgct
gtatttactttcatcattacctttgtgtgtgttgtcctttcctatgtttatatcatcaag
accattttgagatttccctctgccaaacaaagaaaaaaggccttttctacctgttcttcc
cacatgattgtagtttctattgcttatggtagctgcatcttcatttatgtcaaaccttca
tccaaggatgatgtagctatcaataaagggatttcacttattatcatatcaatttcacca
atgttgaatcagtttatttatgcactgagaaacaatcaagtaaagcaagctttcaattac
tcaattaaaaaacttgcattcctctcaaatatgtaa

DBGET integrated database retrieval system