KEGG   Rattus norvegicus (rat): 366854Help
Entry
366854            CDS       T01003                                 

Gene name
Fbxo7
Definition
(RefSeq) F-box protein 7
  KO
K10293  F-box protein 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    366854 (Fbxo7)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     366854 (Fbxo7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI31_Prot_N F-box-like F-box Elongin_A
Motif
Other DBs
NCBI-GeneID: 366854
NCBI-ProteinID: NP_001012222
RGD: 1305648
Ensembl: ENSRNOG00000004637
UniProt: Q68FS3
Position
7q13
AA seq 522 aa AA seqDB search
MKLRVRLQKRTQPLEVPESEPTLGQLRAHLIQDLLPTLGFSSDTRFAITLNNKDALTGDE
ETLASYGIVSGDLICLVLEDEMPAPNLPSSTDSEHSSLQNNDQPPLAATSSQANIPDEQG
SDSSHGQVTQYDAWTDDSMEGPSHSAEAVSIQDAMSVEEASGFHPLEPMLCSETEDGQVP
HSLEALYQSAGCSTVSDALIVLVHLLMLESGYIPQGTEAKAASMPEKWKSSGVYKLQYTH
PLCEGGSAVLTCVPLGKLIMINATIKVNGGIKNVKSVQLKPGAYVRRAEPGESAAKVYKD
LKKLSRLFKDQLVYPLLAFTRQVLNLPDVFGLVVLPLELKLRIFRLLDVHSVLALSAVCH
DLLIASNDPLLWRCLYLRDFRDSTIRGPDTDWKELYRKKHIQRKEAQRMRHVMYLPSVHP
IPFCPIPVYPRPYLPTTLLPPGIIGGEYDERPILPSVGDPVTSLIPRPGEPPSQFRPVRP
RFDPVGPLPGSNSLLPGRASPNNRFPFRPGRGRSADNRLPYL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcgcgtgcggcttcaaaagcggacccagccgctcgaggtgccggagtcggag
ccgacgctcgggcagctgcgcgcgcacctcatccaggacctgctgcccacgttggggttc
agttctgatacccgatttgcaattacattgaacaacaaggatgccctcactggagatgaa
gagaccttggcttcatatgggattgtttctggggacttgatatgtttggttcttgaagat
gaaatgccggcacctaacttaccttcatctacagattcagagcattcctctctccagaat
aatgaccaacctcctttggctgccacctcaagccaggctaacatcccagatgaacaaggg
agtgattcatcccacggacaggtcacccaatatgatgcctggaccgatgacagtatggaa
ggacctagtcacagtgctgaagctgtgtcaattcaggacgccatgagtgtggaagaggct
tctggtttccatccactggagccaatgctctgcagtgaaacagaggacgggcaggtgcca
cattccctagaggccctgtaccagtcagccggctgctccaccgtcagtgatgccttgata
gtgctggtgcatctccttatgcttgagtcgggctacatacctcaggggactgaagccaaa
gcagcatccatgcctgagaaatggaagtcaagtggcgtatacaagctccagtacacacat
cctctctgtgagggcggctctgccgtgcttacctgtgtacctttgggaaagctcatcatg
ataaacgctacaataaaagtcaacggtgggattaaaaatgtgaagtcagtgcagctgaag
ccaggagcctacgttcgcagagcagaaccaggggaaagtgcagctaaagtgtacaaagat
cttaagaagctctctcgtctcttcaaagaccagctggtgtaccctcttctggctttcaca
cgacaagtgctgaacctcccagatgtgtttgggctggttgtccttccactggagctgaaa
ctacgcatcttccgacttctggatgttcattccgtcctggctctgtctgcagtctgccat
gacctcctcattgcatcaaatgacccactgctgtggaggtgcttgtatctgcgggatttt
cgagacagtactatcagaggtcctgacacagattggaaagaattgtacagaaagaagcac
atccaaagaaaagaagcccagaggatgcggcatgtgatgtacctaccgtcagtccaccct
atcccattctgccccattcccgtctaccccaggccctaccttcccaccacgctgcttcct
ccaggaatcattggtggtgaatatgatgagaggccaatattgcctagtgttggggaccca
gtcacctcactcatcccaaggcctggggagcctcctagccagttccgtccagtcagacca
cgttttgatcctgttggcccacttccaggatctaactccctcttaccaggaagagctagc
cccaacaacagatttcccttcagacccggcaggggtcggtcagctgacaaccggctacca
tacctgtga

DBGET integrated database retrieval system