KEGG   Rattus norvegicus (rat): 366894Help
Entry
366894            CDS       T01003                                 

Gene name
Trhde, PAP-II
Definition
(RefSeq) thyrotropin-releasing hormone degrading enzyme
  KO
K01306  pyroglutamyl-peptidase II [EC:3.4.19.6]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    366894 (Trhde)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.6  pyroglutamyl-peptidase II
     366894 (Trhde)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M1
   366894 (Trhde)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 366894
NCBI-ProteinID: NP_001102461
RGD: 728895
Ensembl: ENSRNOG00000005278
UniProt: G3V6Q2
Position
7q22
AA seq 1066 aa AA seqDB search
MALDGERGEQEEEKKKKKKKKKRKKKEEEGAEKSSSPFAATMGEDDAALRASGRGLSDPW
ADSVGVRPRTTERHIAVHKRLVLAFAVSIVALLAVTMLAVLLSLRFDECGASAAMPGTDG
GLGGFPERGGNSSYPGSARRNHHAGEESSQREIGEVGTAGTPSAHPPSEEEQEQWQPWTQ
LRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACQNATRYVVLHASRVAVEKVQVAEDR
AFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRHYNLKIIYNALIENELLGFFRSSYVIHGE
RRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVT
DHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIE
FYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVI
VHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPSWNMEKQRFLTDVLHEVML
LDGLASSHPVSQEVLRATDIDKVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHK
YGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNMTAENRILITQQH
FIYDIGAKTKALQLQNSSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSW
ILGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIP
LEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYSKLGWPKNN
FNGSVVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYC
TGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLSRLLNLSLNSEVVLDQD
AIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKEL
KNFMKSYDGVASASFSRAVETVEANVRWKRLYQDELFQWLGKAMRH
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atggccctggacggcgagaggggggagcaagaggaggagaagaaaaagaagaagaagaaa
aagaagaggaagaagaaggaggaggagggggccgagaagagcagttcaccgtttgcggcc
accatgggagaagacgacgccgcgctccgggcaagcggcagggggctctcggacccgtgg
gctgactcggtgggagtgagaccccgcaccacggagcgccacatcgcagtgcacaagagg
cttgtgctggcttttgccgtgtccatcgtggcactgctggctgtcaccatgctggccgta
ctgctcagcctgcggttcgacgagtgtggagcgagcgcggcgatgccgggcaccgacggt
ggcctcggaggcttccctgagcgtggtggcaacagcagctacccaggatctgcccggcgc
aaccaccacgcgggtgaggaatcctcgcagcgtgagatcggcgaggtgggcaccgcgggg
accccgtctgcccatccgccgtcggaggaagagcaggagcagtggcagccctggactcag
ctgcgcctatccggccaccttaagccgctgcactacaatttgatgctcaccgccttcatg
gagaacttcaccttctctggggaggtcaacgtggagatcgcgtgccagaacgccacccgc
tacgtggtactgcacgcctcccgggtggcggtggagaaggtgcaagtagcggaagaccgg
gcgttcggggctgtcccggtagcaggctttttcctctacccacaaacgcaggtcttggtg
gtggtgctgaatagaaccctggatgcgcagaggcactacaatctgaagattatctacaat
gccctgatagagaacgagcttttgggcttcttccgcagctcctacgtgatccacggggag
agaagattcctcggtgttactcagttttcacctacacatgccaggaaggcatttccatgt
tttgatgaaccaatctacaaggccactttcaaaatcagcatcaaacatcaagcaacctat
ttgtctctctccaacatgcccgtggaaacatctgtgtttgaggaagatggatgggtaaca
gatcacttttcacagacccctctcatgtccacatattatttagcctgggcgatttgcaac
ttcacatacagagaaactactaccaagagtggggttgtagttcgattatatgcaagaccc
gacgctatcagaagaggatccggggactatgctctccacattacaaagagattaatagaa
ttttatgaagactactttaaagtgccctattctttgccaaaactagatcttttagctgtg
cctaagcatccttatgctgctatggagaactggggactaagtatttttgtggaacaaaga
atactgctggatcccagtgtgtcatctatttcttatttgctggatgtcaccatggtcatt
gttcatgaaatatgtcaccagtggtttggtgaccttgtgaccccagtgtggtgggaagat
gtgtggttgaaggaaggctttgctcactactttgaatttgtgggtacagactacctctac
ccttcctggaacatggaaaagcagaggtttctgacagatgttctgcatgaagtgatgctg
cttgacgggttggccagttcccatccagtatcacaggaagtgctacgggcaacagatatt
gacaaagtgtttgactggatcgcatacaaaaagggtgctgctttaataagaatgctggct
aattttatgggccattcagtttttcagaggggattgcaagattatttaaccattcacaag
tatggcaatgcagccagaaatgatctctggaatacattatcagaggctttaaaaaggaat
ggaaaatatgtgaacatacaagaggtaatggatcagtggacactccagatgggatatcct
gttatcaccatcctggggaacatgacggcagaaaacagaatactcatcacccaacagcac
ttcatttacgatatcggtgctaaaaccaaagcacttcaacttcaaaacagcagttacctg
tggcagattccattaaccatcgtcgtaggaaatagaagccatgtgtcttcagaagcaatt
atttgggtgtccaacaaatcagaacatcacagaataacatacttagacaaaggaagctgg
atccttggaaacatcaatcaaactggctacttcagagtcaactatgacctaaggaactgg
agattactgatcgatcagttaatcaggaaccatgaggtactttctgtcagtaaccgtgca
ggcctgattgatgatgccttcagcctggccagggcaggctatttgcctcagaatattccc
ctagagatcatcagatacctctctgaggaaaaggattttcttccttggcatgctgccagc
cgagctctttatcctctggataaattactggaccgcatggaaaactacaatatcttcaat
gaatatattctaaaacaagtggcaacaacctacagcaagcttggatggccaaagaacaac
ttcaatggctctgtcgttcaagcttcctatcaacatgaagagctacggagggaagtgata
atgttggcctgtagctttgggaacaagcactgtcaccagcaggcgtcaactcttatttca
gactggatttccagcaatagaaacagaataccactgaatgttagagacatcgtctactgc
acaggagtgtccctgctggatgaggatgtctgggaattcatctggatgaaattccactcc
accactgcagtttctgagaaaaagatattgctggaggcgctaacttgcagtgatgacagg
aatttactaagtaggcttctgaatctgtctctgaattctgaggtggtgttggatcaagat
gcaattgatgtaataatccacgtagccagaaatccacatggccgagaccttgcctggaag
tttttcagagataaatggaaaatactaaataccaggtatggagaagcattatttatgaat
tccaaacttatcagtggagttacagaatttcttaatacagaaggtgaacttaaagagcta
aagaacttcatgaagtcctatgatggggtagcatctgcttctttctcacgagccgtggaa
accgtggaagccaatgtgcgctggaaaaggctttatcaagatgagcttttccagtggctg
ggaaaagccatgaggcactaa

DBGET integrated database retrieval system