KEGG   Rattus norvegicus (rat): 366957Help
Entry
366957            CDS       T01003                                 

Gene name
Rac2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04650  Natural killer cell mediated cytotoxicity
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05416  Viral myocarditis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    366957 (Rac2)
   04015 Rap1 signaling pathway
    366957 (Rac2)
   04010 MAPK signaling pathway
    366957 (Rac2)
   04310 Wnt signaling pathway
    366957 (Rac2)
   04370 VEGF signaling pathway
    366957 (Rac2)
   04071 Sphingolipid signaling pathway
    366957 (Rac2)
   04024 cAMP signaling pathway
    366957 (Rac2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    366957 (Rac2)
   04520 Adherens junction
    366957 (Rac2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    366957 (Rac2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    366957 (Rac2)
   04662 B cell receptor signaling pathway
    366957 (Rac2)
   04664 Fc epsilon RI signaling pathway
    366957 (Rac2)
   04666 Fc gamma R-mediated phagocytosis
    366957 (Rac2)
   04670 Leukocyte transendothelial migration
    366957 (Rac2)
   04062 Chemokine signaling pathway
    366957 (Rac2)
  Development
   04360 Axon guidance
    366957 (Rac2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    366957 (Rac2)
   05231 Choline metabolism in cancer
    366957 (Rac2)
   05210 Colorectal cancer
    366957 (Rac2)
   05212 Pancreatic cancer
    366957 (Rac2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    366957 (Rac2)
   05416 Viral myocarditis
    366957 (Rac2)
  Infectious diseases
   05163 Human cytomegalovirus infection
    366957 (Rac2)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    366957 (Rac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 366957
NCBI-ProteinID: NP_001008385
RGD: 1307568
Ensembl: ENSRNOG00000007350
UniProt: Q5U1Y2
Position
7q34
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRPCSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggtgatggagccgtgggcaagacatgccttctc
atcagctacaccaccaatgccttccccggagaatacatccccactgtgtttgacaactac
tcagccaatgtgatggtggacagtaaacctgtgaacctggggctgtgggacactgcaggc
caggaggactatgaccgcctccggccactctcctacccacagacagacgtgttcctcatc
tgcttctcgctagtcagcccggcctcctacgagaacgtccgagccaagtggttccctgag
gtacggcaccactgccccagcacccccatcatcctggtgggtaccaagctggaccttcga
gatgacaaggacaccattgagaagctgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggatattgattcagtgaagtacttggaatgttctgcactc
acccagcgaggcctgaagaccgtcttcgatgaggcaatccgagcagtcctgtgcccacag
cccacacggcagcagaaacgcccctgcagcctgctctag

DBGET integrated database retrieval system